Microwave Oven With Removable Storage Cassette in Dashboard of Motor Vehicle
A microwave oven adapted for use within a motor vehicle dashboard area. The microwave oven has a removable storage cassette, and slidable platforms for securing and serving containers of beverages and foods.
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 5328898 | Factor XIIIA fibrin binding fragments Fibrin binding peptides disclosed include (a) peptides having the amino acid sequence of a human Blood Coagulation Factor XIIIA fragment (i.e., NKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDR SVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTY... | 07/12/1994 |