U.S. patents available from 1976 to present.
U.S. patent applications available from 2005 to present.

Icon_funbox Quotables

"Inventing is a combination of brains and materials. The more brains you use, the less material you need."

Charles Kettering

Newsletter  PatentStorm News

Make the Most of Our Site

See this month's Top Inventors and Most Cited Patents.

Stay on top of the latest innovations by subscribing to an RSS feed.

Registered users: Manage your profile.

 

Class 530/856 - Snakes; venom


Subclass of Class 530 - Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
Definition: Cross-reference art collection for peptides or proteins
No. of patents: 35
Last issue date: 05/29/2007


NumberTitleIssue Date
7223730Antithrombosis enzyme from the snake venom of agkistrodon acutus
This invention features an antithrombosis enzyme extracted and purified from the snake venom of Southern-Anhui Agkistrodon acutus and pharmaceutical uses thereof. ...
05/29/2007
7192925Scorpion peptide as hypotensive agent
The present invention provides isoformes from a peptide family belonging to South American scorpion Tityus serrulatus that acts as hypotensive agents by potentiating Bradykinin and, therefore, can be used as anti-hypertensive drugs. A peptide was firstly isol...
03/20/2007
6833131Antivenom immunesera
An antivenom comprising a mixture of monospecific antisera each raised against venoms of one species or sub-species is disclosed. Also disclosed is a pharmaceutical composition comprising the antivenom of the invention, and a method of treating envenomation in a mam...
12/21/2004
6818617EC-3, an inhibitor of α4β1 and α4β7 integrins
This invention relates to the identification, purification, and characterization of a novel heterodimeric disintegrin, EC-3, from Echis carinatus viper venom. EC-3 inhibits α4 integrins in an RGD-independent manner. The invention further relates to methods o...
11/16/2004
6660280Collagen product containing collagen of marine origin with a low odor and preferably with improved mechanical properties, and its use in the form of cosmetic or pharmaceutical compositions or products
The invention relates to a collagen product containing collagen of marine origin with a low odor. The collagen product includes one or more collagens or derivatives thereof, including hydrolyzates, with a low odor, at least part of the collagen or the der...
12/09/2003
6630139Fibrinogenolytic proteases with thrombolytic and antihypertensive activities: medical application and novel process of expression and production
The present invention provides a process of producing highly purified proteases. The invention further provides the use of such purified proteases in treating cardiovascular disorders, including hypertension, stroke and thrombosis....
10/07/2003
6555109Analgesic from snake venom
A substantially non-toxic fraction isolated from the venom of Vipera xanthina is disclosed which fraction has an analgesic effect. The fraction is preferably purified on an ion exchange column from Vipera xanthina palestinae. Also described are a pharmace...
04/29/2003
6106830Methods for the treatment of apoptosis-related diseases by batroxobin
A pharmaceutical composition for prophylaxis and/or treatment of apoptosis-related diseases which comprises as an effective ingredient batroxobin....
08/22/2000
5972681Calcium-requiring prothrombin activator
An object of the present invention is to provide a novel prothrombin activator. The application of the activator to thrombin-related diseases is expected. Described is a prothrombin activator derived from snake venom, which is a calcium requiring type and...
10/26/1999
5904922Treatment with polyvalent antivenom containing immunoglobulin which is greater than 50% venom-reactive
Antivenoms to snake, spider, scorpion and jelly fish venoms are produced for treatment of humans and animals, and for analytical use. Polyvalent antivenoms are produced containing immunoglobulin which is greater than fifty percent venom reactive. Purified...
05/18/1999
5856126Peptide having anti-thrombus activity and method of producing the same
A multimer peptide from a snake venom has an activity to inhibit binding between von Willebrand factor and platelets. The multimer peptide is used to obtain a single strand peptide which does not substantially cause decrease in platelets at a minimum dose...
01/05/1999
5831025Human activated protein C and process for preparing same
A human Activated Protein C preparation with a high specific activity of 3500 U/mg or more and substantially free from thrombin or other proteases which can convert Protein C into Activated Protein C is provided. A process for preparing this human Activat...
11/03/1998
5759858Calibrator and use thereof in an immunoassay
The invention relates to a composition comprising among others a fibrinopeptide A releasing compound. Furthermore the invention relates to the use of the composition as calibrator in plasma containing fibrinogen. A test kit comprising the said composition...
06/02/1998
5759541Recombinant fibrinogenases, the preparation and use thereof
Novel polypeptides having fibrinogenolytic properties and having amino acid sequences as SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6 indicated in the Sequence Listing, the preparation and use thereof for controlling diseases....
06/02/1998
5648339Herpoxin: herpes virus inhibitor and method
Herpoxin, herpes virus inhibitor consists of two proteins isolated from snake venom of Naja n. kaouthia, which separately and together inhibit the replication of herpes simplex viruses type 1 and type 2 in cell cultures. Herpoxin is characterized as a pur...
07/15/1997
5576297Embodiments of natural and synthetic lethal toxin neutralizing factors and their utility as treatment for envenomation
Opossum whole serum exhibits a life saving property by neutralizing the lethality of venoms from all major families of poisonous snakes, and therefore an injection of Opossum serum can used as a novel treatment for many types of envenomation. Preferably, ...
11/19/1996
5565431Cancer cell inhibitors and method
Novel cancer cell inhibitors have been isolated from the venoms of poisonous snakes Crotalus atrox and Naja n. kaouthia; they are called Atroporin and Kaotree, respectively. The cancer cell inhibitors Atroporin and Kaotree are characterized as potent anti...
10/15/1996
5523287Thrombin-inhibitory protein from assassin bugs
A novel thrombin-inhibitory protein from assassin bugs with a molecular weight of about 12,000 dalton and the N terminus Glu-Gly-Gly-Glu-Pro-Cys-Ala-Cys-Pro-His-Ala-Leu-His-Arg-Val-Cys-Gly-Ser-As p is described. The protein is suitable for controlling dise...
06/04/1996
5523292Method of preventing restenosis following coronary angioplasty
The present invention comprises a method of alleviating restenosis, post-PTCA or other coronary arterial intervention, and more particularly, to the use of ancrod to prevent restenosis in the coronary arteries....
06/04/1996
5447911Ghilanten antimetastatic principle from the south american leech, Haementeria ghilianii
A method for the inhibition of tumor metastases is described herein. The method makes use of the administration of an antimetastatic factor isolated from the leech Haementeria ghilianii....
09/05/1995
5342830Antithrombosis agents
Platelet antiadhesives (PAA) which are useful as antithrombotics are obtainable from snake venoms which have been identified using an assay which measures the ability of the venom to inhibit ristocetin- or botrocetin-induced agglutination of platelets in ...
08/30/1994
5242810Bifunctional inhibitors of thrombin and platelet activation
The present invention relates to novel, bifunctional inhibitors of both platelet activation and thrombin. These bifunctional inhibitors are characterized by two domains -- a glycoprotein IIb/IIIa inhibitory domain and a thrombin inhibitory domain. The inv...
09/07/1993
5232911Mixture of a non-covalent heterodimer complex and a basic amphiphatic peptide as cytotoxic agent
Novel cytotoxic agent useful against malignant tumors. It provides a stable composition of matter based on the cytotoxic activity of two synergistically acting toxins which sequence are herein described. The basic amphipathic peptide binds to the cell mem...
08/03/1993
5196193Antivenoms and methods for making antivenoms
The production of antivenoms in non-mammals and improvements in the effectiveness of both non-mammalian antivenoms and mammalian antivenoms so that they are more suitable for treatment of humans and animals as well as for analytical use....
03/23/1993
5182260DNA sequences encoding snake venom inhibitors of platelet activation processes for producing those inhibitors and compositions using them
The present invention relates to polypeptide inhibitors of platelet activation and derivatives thereof, purified from the venom of the North American Water Moccasin and to methods for their purification. This invention also relates to DNA sequences and re...
01/26/1993
5164196Crotoxin complex as cytotoxic agent
The present invention provides a stable composition of matter based on the cytotoxic activity of a basic phospholipase A2 of molecular weight 14,500 and isoelectric point 9.6-9.7 (crotoxin B) isolated from the venom of Crotalus durissus terrifi...
11/17/1992
5066592Trigramin - a platelet aggregation inhibiting polypeptide
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprote...
11/19/1991
5053492Immunopurification using monoclonal antibodies to Mojave toxin
Monoclonal antibodies to Mojave toxin and use for isolation of cross-reacting proteins in Crotalus venoms are disclosed. Hybridomas secreting monoclonal antibodies against Mojave toxin were established. The antibodies were used for identifying cross-react...
10/01/1991
4774318Snake venom growth arresting peptide
Novel cytotoxic agents are provided as small polypeptides related to a low molecular weight peptide derived from Crotalus atrox. The compounds may be used by themselves or in combination with other reagents, such as antibodies, for inhibiting cell growth....
09/27/1988
4731439Snake venom growth arresting peptide
Novel cytotoxic agents are provided as small polypeptides related to a low molecular weight peptide derived from Crotalus atrox. The compounds may be used by themselves or in combination with other reagents, such as antibodies, for inhibiting cell growth....
03/15/1988
4661346Immunological compositions including a peptide and osmium or ruthenium tetroxide
Immunogenic compositions comprising a peptide or protein material together with an oxide selected from the group consisting of osmium tetroxide, potassium permanganate and ruthenium oxide, and antibodies raised by the use of such a composition, are of val...
04/28/1987
4469677Polypeptide active immunosuppressant fraction
Immunosuppressive polypeptide fractions prepared by enzymatic digestion of specific allergens are non-reactive in animals and humans and effective by parenteral administration, the immunosuppression being antigen specific, affecting production of immunogl...
09/04/1984
4372883Process for the production of vaccine
The present invention relates to a process for the production of vaccine, characterized by covalent attachment of a biologically toxic substance to a saccharide both to form a biologically toxic substance-saccharide conjugate and to detoxify said substanc...
02/08/1983
4357272Recovering purified antibodies from egg yolk
Immunological preparations are prepared by immunizing hens with an antigen, preferably to a stage of hyperimmunization. The eggs of the immunized hens are collected, the yolk is separated from the eggs, followed by separation of the lipid content of the y...
11/02/1982
4350625Substance with fibrinolytic activity and method of manufacturing the same
This invention relates to a new fibrinolytic substance and the method of manufacturing the same which can be singly isolated from venom of venomous snakes belonging to the family of Trimeresurus taxonomically by means of molecular sieve chromatography and...
09/21/1982
 
Sign InRegister
Username  
Password   
forgot password?