U.S. patents available from 1976 to present.
U.S. patent applications available from 2005 to present.

Icon_funbox Bizarre Patents

Patent No. 5823572

Self Defense Weapon With Memo

A self defense weapon formed as a memo pad and which is easily held by a person's fingers, therefore making it possible to provide protection from a mugger and also to quickly and easily write a record or a message without failure of missing or forgetting significant information under a stressful situation.

Newsletter  PatentStorm News

Make the Most of Our Site

See this month's Top Inventors and Most Cited Patents.

Stay on top of the latest innovations by subscribing to an RSS feed.

Registered users: Manage your profile.

 

Class 530/825 - Bacteria


Subclass of Class 530 - Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
Definition: Cross-reference art collection for peptides or proteins
No. of patents: 525
Last issue date: 09/13/2011


1                      
NumberTitleIssue Date
8017741Chimera botulinum toxin type E
The present invention relates to a toxin comprising a modified light chain of a botulinum toxin type E, wherein the modified light chain comprises amino acid sequence PFVNKQFN (SEQ ID NO: 120) at the N-terminus, and amino acid sequence xDxxxLL (SEQ ID NO: 111) at th...
09/13/2011
7691983Chimera botulinum toxin type E
The present invention relates to a toxin comprising a modified light chain of a botulinum toxin type E, wherein the modified light chain comprises amino acid sequence PFVNKQFN (SEQ ID NO: 120) at the N-terminus, and amino acid sequence xExxxLL (SEQ ID NO: 112) at th...
04/06/2010
7425436Covalent tethering of functional groups to proteins and substrates therefor
A mutant hydrolase optionally fused to a protein of interest is provided. The mutant hydrolase is capable of forming a bond with a substrate for the corresponding nonmutant (wild-type) hydrolase which is more stable than the bond formed between the wild-type hydrola...
09/16/2008
7425535Therapeutic pore-forming peptides
A class of procytotoxic agents is characterized by a capability to kill with target cell-specificity. Such an aspect can be a pore-forming protein which has at least one lysine residue, modified by a peptide linkage to an amino acid residue, via the epsilon amino gr...
09/16/2008
7404961Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ...
07/29/2008
7402316Group A streptococcal vaccines
The present invention provides methods for eliciting an immune response against Group A streptococci, comprising use of recombinant fusion polypeptides, and compositions thereof, that include a multivalent immunogenic portion of at least two immunogenic polyp...
07/22/2008
7384645Outer membrane vesicles from gram negative bacteria and use as a vaccine
A composition is prepared from a mixture of different vesicles, such as outer membrane vesicles (OMVs) and vaccines are based thereon. Another composition comprises in a single vesicle a combination of antigens and/or other vesicle components deriving from separate ...
06/10/2008
7371821Cloning and expression of the full length 110 kDa antigen of to be used as a vaccine component against scrub typhus
The inventive subject matter relates to a recombinant 110 kDa protein from O. tsutsugamuchi, Karp, Kato and Gilliam strains and for a DNA expression system containing DNA encoding the 110 kDa protein of O. tsutsugamuchi. The invention also relates to t...
05/13/2008
7339037Glycosylation-resistant cyanovirins and related conjugates, compositions, nucleic acids, vectors, host cells, methods of production and methods of using nonglycosylated cyanovirins
The invention provides a method of inhibiting prophylactically or therapeutically an influenza viral infection in a host. The method comprises instilling into or onto a host a cell producing an antiviral protein, antiviral peptide, or antiviral conjugate comprising ...
03/04/2008
7306808truncated recombinant outer membrane protein (r47) and (r57) vaccines diagnostics and therapeutics for scrub typhus
A scrub typhus vaccine comprising truncated r47 protein and truncated r56 protein is disclosed. Vaccines composed of r56 protein variants are also disclosed. Methods of reducing HIV viral loads using r47 and r56 proteins and antibodies raised against r47 and r56 are...
12/11/2007
7285632Isolated toxin complex proteins from
The subject invention relates to novel Xenorhabdus toxin complex (TC) proteins encoded by genes from Xenorhabdus bovienii strain ILM 104, and methods of controlling an insect with the toxin proteins. ...
10/23/2007
7279169Mucosal DTPa vaccines
Mucosal DTPa vaccines, especially intranasal vaccines, comprising (a) a diphtheria antigen, a tetanus antigen and an acellular pertussis antigen, and (b) a detoxified mutant of cholera toxin (CT) or E. coli heat labile toxin (LT). Component (b) acts as a muco...
10/09/2007
7270827Multivalent streptococcal vaccine compositions and methods for use
Compositions and methods for making and using therapeutic formulations of multivalent hybrid polypeptides comprising immunogenic peptides of M proteins from various different serotypes of group A streptococci and antibodies thereto are provided. Also provided are nu...
09/18/2007
7258863Heterologous protection induced by immunization with invaplex vaccine
In this application is described a composition, Invaplex, derived from a gram negative bacteria for use in generating an immune response in a subject against one or more heterologous species or strains of gram-negative bacteria. ...
08/21/2007
7256265Streptococcal C5a peptidase vaccine
Novel vaccines for use against β-hemolytic Streptococcus colonization or infection are disclosed. The vaccines contain an immunogenic amount of a variant of streptococcal C5a peptidase (SCP). Also disclosed is a method of protecting a susceptible mamm...
08/14/2007
7255863Group A streptococcal vaccines
The present invention provides methods for eliciting an immune response against Group A streptococci, comprising use of recombinant fusion polypeptides, and compositions thereof, that include a multivalent immunogenic portion of at least two immunogenic polyp...
08/14/2007
7253275Porin B (PorB) as a therapeutic target for prevention and treatment of infection by
The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising o...
08/07/2007
7223412Staphylococcal enterotoxin SEC-SER, expression vector and host cell, production method thereof, and manufacturing method of vaccine
The present invention relates to a method of producing recombinant modified Staphylococcal toxin having improved stability, comprising the steps of preparing a modified toxin in which a specific amino acid sequence is substituted and a vector for expressing the modi...
05/29/2007
7223836Peptides for chlamydophila pneumoniae vaccine and diagnosis
Peptides are disclosed that include SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, or a conservative variant or mimic thereof, wherein the conservative variant or mimic specifically binds an antibody that specifically binds SEQ ID...
05/29/2007
7211647DNA synthetase
The object of the invention is to provide proteins that have both DNA primase activity and DNA polymerase activity. This subject is solved by a protein (p41) that has an amino acid sequence shown in SEQ ID NO: 1. This is for the first time that proteins that have bo...
05/01/2007
7208574Host receptor for pathogenic bacteria
A polypeptide, called Tir (for translocated intimin receptor, which is secreted by attaching and effacing pathogens, such as the enteropathogenic (EPEC) and enterohemorrhagic (EHEC) E. coli. These bacterial pathogens inserts their own receptors into mammalian...
04/24/2007
7204991Porphyromonas gingivalis recombinant proteins and truncations
The present invention relates to soluble P. gingivalis polypeptides derived from PG32 and PG33 and to polynucleotides encoding these polypeptides. The P. gingivalis polypeptides and nucleotides can be used in compositions for use in raising an immune r...
04/17/2007
7204992P153 and P156 antigens for the immunodiagnosis of canine and human ehrlichioses and uses thereof
Sequences encoding two immunoreactive glycoproteins were cloned from Ehrlichia canis (p153 gene) and Ehrlichia chaffeensis (p156 gene). These two glycoproteins are species-specific immunoreactive orthologs that are useful as subunit vaccines and for se...
04/17/2007
7192596Recombinant toxin fragments
A single polypeptide is provided which comprises first and second domains. The first domain enables the polypeptide to cleave one or more vesicle or plasma-membrane associated proteins essential to exocytosis, and the second domain enables the polypeptide to be tran...
03/20/2007
7189405Peptide mimics of conserved gonococcal epitopes and methods and compositions using them
The present invention relates to peptide mimics of a conserved gonococcal epitope of Neisseria gonorrhoeae, which epitope is not found on human blood group antigens. This invention also relates to methods and compositions using such peptide mimics for the pro...
03/13/2007
7172762antigens and vaccine compositions
The invention relates to stabilized antigen compositions of Erysipelothrix rhusiopathiae and vaccine formulations containing such antigen compositions. Antigens of the invention are effective in providing long-term protection against erysipelas in animals.
02/06/2007
7157089Immune responses using compositions containing stress proteins
The present invention relates to a vaccine for inducing an immune response to an antigen in a vertebrate (e.g., mammal) comprising an antigen and all or a portion of a stress protein or all or a portion of a protein having an amino acid sequence sufficiently homolog...
01/02/2007
7144580outer membrane protein P1pE as a vaccine or vaccine component against shipping fever
Vaccines and methods against M. haemolytica infections in cattle. The vaccine compositions include a recombinant outer membrane protein of M. haemolytica designated PlpE and/or subunits thereof, alone or in combination with other antigenic components, ...
12/05/2006
7141244proteins useful for vaccines and diagnostics
This invention provides polypeptides of Helicobacter pylori cytotoxin associated immunodominant (CAI) antigen. The invention also provides prophylactic and therapeutic vaccines comprising polypeptides of Helicobacter pylori CAI antigen, and methods for...
11/28/2006
7132107Streptococcus pneumoniae proteins and vaccines
The present invention relates to novel immunogenic polypeptides, and fragments thereof, and vaccines for the prevention and treatment of pneumococcal infection, especially by Streptococcus pneumoniae. The invention also relates to antibodies against the discl...
11/07/2006
7118756Recombinant protective protein from
The present invention discloses amino acid sequences and nucleic acid sequences relating to a Streptococcus Pneumoniae surface associated Pneumo Protective Protein (PPP) having a molecular weight of about 20 kilo Daltons (kDa). The PPP exhibits the ability to...
10/10/2006
7118757Meningococcal class 1 outer-membrane protein vaccine
Outer-membrane vesicles, Class 1 outer membrane proteins of Neisseria meningitidis, fragments or oligopeptides containing epitopes of the Class I OMP can be used to immunize against meningococcal disease. ...
10/10/2006
7105171Porin B (PorB) as a therapeutic target for prevention and treatment of infection by
The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising o...
09/12/2006
7094750Therapeutic pore-forming peptides
A class of procytotoxic agents is characterized by a capability to kill with target cell-specificity. Such an aspect can be a pore-forming protein which has at least one lysine residue, modified by a peptide linkage to an amino acid residue, via the epsilon amino gr...
08/22/2006
7087236Method for inducing a cell-mediated immune response and improved parenteral vaccine formulations thereof
A method of inducing either a TH1 polarized immune response, a TH2 polarized immune response or a combined TH1 and TH2 response to an antigen and associated vaccine formulations are disclosed. A method is provided for indu...
08/08/2006
7083792Immunologically active proteins from
Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or we...
08/01/2006
7081513Nucleic acids encoding (poly) peptides having chips activity
The invention relates to nucleic acid molecules encoding (poly)peptides having chemotaxis inhibiting (poly)peptides CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for...
07/25/2006
7081244Neisserial vaccine compositions and methods
Methods and compositions for the treatment of microbial infection, and in particular meningococcal disease, comprise a commensal Neisseria or an extract of a commensal Neisseria. Further methods and compositions comprise conimensal Neisseria whi...
07/25/2006
7074416Antigen of hybrid M protein and carrier for group A streptococcal vaccine
Recombinant hybrid streptococcal M protein antigens are provided which elicit protective antibodies against Group A streptococci and prevent rheumatic fever. Recombinant hybrid genes which encode the antigen are provided. Vaccine compositions and methods of administ...
07/11/2006
7063850Protective antigen of group A
The present invention provides the discovery of a new Streptococcus protective antigen (herein designated Spa) which has been identified and isolated from Streptococci. Spa is a surface antigen distinct from M protein which evokes opsonic antibodies that are ...
06/20/2006
1                      
 
Sign InRegister
Username  
Password   
forgot password?