Did You Know...
...that on Dec. 15, 1836, the Patent Office was completely destroyed by fire? Lost were some 7,000 models, 9,000 drawings, and 230 books plus all records of patent applications and grants.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 7592418 | Biocompatible crosslinked polymers with visualization agents Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros... | 09/22/2009 |
| 7332566 | Biocompatible crosslinked polymers with visualization agents Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros... | 02/19/2008 |
| 7313829 | Sealing device for body suit and sealing method using hydrogels A sealing device for a body suit and a sealing method utilize a reactive seal that incorporates a swelling polymer activated upon contact with a fluid medium, such as water. The reactive seal can be embodied in a neck seal, wrist seal, or ankle seal of the body suit... | 01/01/2008 |
| 7291697 | Resinates from monomer Reduced-rosin compositions of printing inks and the resinate binders therein, and the processes of preparation thereof, are described. In said compositions, a portion of the rosin normally used in the art is replaced by Monomer, and is further reacted with α,β-uns... | 11/06/2007 |
| 7235262 | Use of bioactive fraction from cow urine distillate (‘’) as a bio-enhancer of anti-infective, anti-cancer agents and nutrients The invention relates to a novel pharmaceutical composition comprising an effective amount of bio-active fraction from cow urine distillate as a bioavailability facilitator and pharmaceutically acceptable additives selected from anticancer compounds, antibiotics, dr... | 06/26/2007 |
| 7112653 | Composition and method for preserving progenitor cells The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12–20 kD, or has an am... | 09/26/2006 |
| 7074438 | Compositions for oral delivery of nutrients and pharmaceuticals The present invention provides novel compositions and methods for protecting and promoting cell growth and restoring physiological structure and function to mucosal tissue of the body, especially mucosa in the gastrointestinal tract. The composition can be used as a... | 07/11/2006 |
| 7037674 | Cytochrome P450 reductases from poppy plants The present invention relates to production of alkaloids from poppy plants and in particular togenes encoding enzymes in the alkaloid pathway, to proteins encoded by the gens, to plants transformed or transfected with the genes and to methods of altering alkaloid co... | 05/02/2006 |
| 7009034 | Biocompatible crosslinked polymers Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros... | 03/07/2006 |
| 6887974 | Crosslinking agents and methods of use Polymeric crosslinking agents are disclosed that have an inert water soluble polymeric component, biodegradable components, functional components reactive with chemical groups on a protein, for example, amine or thiol groups. The inert polymeric component may be fla... | 05/03/2005 |
| 6875842 | Resinates from monomer Reduced-rosin compositions of printing inks and the resinate binders therein, and the processes of preparation thereof, are described. In said compositions, a portion of the rosin normally used in the art is replaced by Monomer, and is further reacted with α,β-uns... | 04/05/2005 |
| 6844420 | Natural resin formulations This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapors and char from biomass, ... | 01/18/2005 |
| 6706858 | Use of alkanes for contamination-free purification or separation of biopolymers The present invention relates to the use of alkanes for the contamination-free purification or separation of biopolymers. ... | 03/16/2004 |
| 6555649 | Natural resin formulations This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapours and char fr... | 04/29/2003 |
| 6476209 | Polynucleotides, materials incorporating them, and methods for using them Novel polynucleotides isolated from Lactobacillus rhamnosus, as well as probes and primers, genetic constructs comprising the polynucleotides, biological materials, including plants, microorganisms and multicellular organisms incorporating the polynucleot... | 11/05/2002 |
| 6433121 | Method of making natural oil-based polyols and polyurethanes therefrom A method for making natural oil-based polyols directly from vegetable or animal oil using a consecutive two-step process involving epoxidation and hydroxylation is provided. Specifically, this process comprises adding a peroxyacid to a natural oil wherein... | 08/13/2002 |
| 6326461 | Natural resin formulations This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapors and char fro... | 12/04/2001 |
| 6280724 | Composition and method for preserving progenitor cells The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12-20 kD, or ... | 08/28/2001 |
| 6228623 | Polyhydroxyalkanoates of narrow molecular weight distribution prepared in transgenic plants Methods for the biosynthesis of polyhydroxyalkanoate homopolymers and copolymers are described. In a preferred embodiment, the polymers have a single mode molecular weight distribution, and more preferably have a distribution of between about 2 and about ... | 05/08/2001 |
| 6146842 | High-throughput screening assays utilizing metal-chelate capture A high throughput enzyme screen has been developed which relies on metal chelate interaction for capture of the product of the enzymatic reaction. In the present assay system, a detectable moiety is attached to a substrate having a chelating capturable mo... | 11/14/2000 |
| 6084060 | Composition and method for preserving progenitor cells The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12-20 kD, or ... | 07/04/2000 |
| 5981469 | 78 residue polypeptide (NK-lysine) and its use A 78 residue polypeptide comprising the following amino acid sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKK PQAICVDIKICKE [SEQ ID NO:1]: and functional derivatives and pharmaceutically acceptab... | 11/09/1999 |
| 5922324 | Propolis extract with improved water-solubility A propolis extract which is prepared by adjusting the pH of propolis to 5.5-7.0 to improve the water-solubility of the effective ingredients of propolis, a composition containing the propolis extract, and a method for improving the water-solubility of pro... | 07/13/1999 |
| 5821285 | Method of preparing filler containing forms of chitin The method relates to the preparation of dry chitin forms of consistent shape that incorporates an advantageous additive such as fillers or reinforcement during the preparation process to give dry forms of chitin with consistent shape typically known as f... | 10/13/1998 |
| 5703040 | Broad spectrum antibiotic peptide Improved antimicrobial proteinaceous substances produced by Staphylococcus aureus KSI1829 (e.g., Bac1829) and methods of inhibiting microbial growth using such substances are disclosed.... | 12/30/1997 |
| 5698668 | Modified natural-resin acid esters, processes for their preparation, and their use as binder resins in printing inks Toluene-soluble modified natural-resin acid esters which can be prepared by reacting at least one compound from each of the component groups: A) natural resins or natural-resin acids; B) ,ଲ-ethylenically unsaturated carboxylic acids or their ... | 12/16/1997 |
| 5691154 | Enzyme linked immunoassay with stabilized polymer saccharide enzyme conjugates An improvement in enzyme linked immunoassays is disclosed wherein the enzyme is in the form of a water soluble polymer saccharide conjugate which is stable in hostile environments. The conjugate comprises the enzyme which is linked to the polymer at multi... | 11/25/1997 |
| 5621072 | Purified guaiacum resin and method for making same A purified guaiacum resin which is obtained by isolation from a natural guaiacum resin with chromatography using a gel for reversed chromatography as a stationary phase and a polar solvent as a mobile phase. The purified guaiacum resin does not contain su... | 04/15/1997 |
| 5556454 | Modified natural resin esters, processes for their preparation and their use as binder resins in printing inks Toluene-soluble modified natural resin esters suitable as binder resins in ground pigments and printing inks for halftone gravure printing prepared by reacting at least one compound from each of the following substance groups A) to D) A) natural resins an... | 09/17/1996 |
| 5492821 | Stabilized polyacrylic saccharide protein conjugates This invention is directed to water soluble protein polymer conjugates which are stabile in hostile environments. The conjugate comprises a protein which is linked to an acrylic polymer at multiple points through saccharide linker groups.... | 02/20/1996 |
| 5157109 | Preparation of novel synthetic resins A process for the preparation of novel resin comprising reacting cyclopentadienes, preferably dicyclopentadienes, with tall oil pitch or a neutrals-containing component thereof, at a temperature between about 200° C. and about 300° C. is described. The ... | 10/20/1992 |
| 5130419 | Process for preparing lignocellulosic bodies Process for preparing lignocellulosic bodies by bringing lignocellulosic parts into contact with a composition comprising a polyisocyanate, fumed silica and a non-ionic liquid gellant and by pressing this combinations of parts and composition. The adhesio... | 07/14/1992 |
| 5049652 | Use of a mixed catalyst system to improve the viscosity stability of rosin resins Rosin esters having improved viscosity stability are prepared by heating a mixture of rosin and a polyol in the presence of a catalyst mixture of 0.1% to 0.6% by weight calcium bis(ethyl 3,5-di-t-butyl-4-hydroxybenzyl phosphonate) and 0.02 to 1.0% by weig... | 09/17/1991 |
| 4876331 | Copolyester and process for producing the same According to the present invention, a novel copolyester comprising 3-hydroxybutyrate unit, 3-hydroxyvalerate unit and 5-hydroxyvalerate unit; 3-hydroxybutyrate unit and 4-hydroxybutyrate unit; or 3-hydroxybutyrate unit, 4-hydroxybutyrate unit and 3-hydrox... | 10/24/1989 |
| 4806285 | Hydrogenated grindelia acids and their methyl, glycerol and pentaerythritol esters Novel diterpene compounds are separated from dry biomass of Grindelia camporum. The separated compounds are then hydrogenated and esterified. Both the hydrogenated and ester products are useful as tackifiers.... | 02/21/1989 |
| 4382886 | Method for extracting propolis and water soluble dry propolis powder A new and useful method for extracting propolis from substantially clean raw material to obtain a dry propolis powder. Depending upon the method employed, either a water soluble propolis powder or an organic soluble propolis powder may be obtained. A uniq... | 05/10/1983 |
| 4297271 | Guaiaconic acid A from guaiac resin The invention provides a diagnostic agent for the detection of occult blood in feces comprising hydrogen peroxide and, as a chromogen, guaiaconic acid A, optionally with a stabilizer. The invention provides, as a novel substance, guaiaconic acid A having ... | 10/27/1981 |
