U.S. patents available from 1976 to present.
U.S. patent applications available from 2005 to present.

Icon_funbox Did You Know...

...that on Dec. 15, 1836, the Patent Office was completely destroyed by fire? Lost were some 7,000 models, 9,000 drawings, and 230 books plus all records of patent applications and grants.

Newsletter  PatentStorm News

Make the Most of Our Site

See this month's Top Inventors and Most Cited Patents.

Stay on top of the latest innovations by subscribing to an RSS feed.

Registered users: Manage your profile.

 

Class 530/200 - NATURAL RESINS OR DERIVATIVES (E.G., WOOD OR PINE TAR; CATIVO RESIN DERIVATIVES, ETC.)


Subclass of Class 530 - Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
Definition: Natural resin derivatives which are not pure compounds,
No. of patents: 37
Last issue date: 09/22/2009


NumberTitleIssue Date
7592418Biocompatible crosslinked polymers with visualization agents
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros...
09/22/2009
7332566Biocompatible crosslinked polymers with visualization agents
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros...
02/19/2008
7313829Sealing device for body suit and sealing method using hydrogels
A sealing device for a body suit and a sealing method utilize a reactive seal that incorporates a swelling polymer activated upon contact with a fluid medium, such as water. The reactive seal can be embodied in a neck seal, wrist seal, or ankle seal of the body suit...
01/01/2008
7291697Resinates from monomer
Reduced-rosin compositions of printing inks and the resinate binders therein, and the processes of preparation thereof, are described. In said compositions, a portion of the rosin normally used in the art is replaced by Monomer, and is further reacted with α,β-uns...
11/06/2007
7235262Use of bioactive fraction from cow urine distillate (‘’) as a bio-enhancer of anti-infective, anti-cancer agents and nutrients
The invention relates to a novel pharmaceutical composition comprising an effective amount of bio-active fraction from cow urine distillate as a bioavailability facilitator and pharmaceutically acceptable additives selected from anticancer compounds, antibiotics, dr...
06/26/2007
7112653Composition and method for preserving progenitor cells
The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12–20 kD, or has an am...
09/26/2006
7074438Compositions for oral delivery of nutrients and pharmaceuticals
The present invention provides novel compositions and methods for protecting and promoting cell growth and restoring physiological structure and function to mucosal tissue of the body, especially mucosa in the gastrointestinal tract. The composition can be used as a...
07/11/2006
7037674Cytochrome P450 reductases from poppy plants
The present invention relates to production of alkaloids from poppy plants and in particular togenes encoding enzymes in the alkaloid pathway, to proteins encoded by the gens, to plants transformed or transfected with the genes and to methods of altering alkaloid co...
05/02/2006
7009034Biocompatible crosslinked polymers
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having electrophilic and nucleophilic functional groups capable of reacting and cros...
03/07/2006
6887974Crosslinking agents and methods of use
Polymeric crosslinking agents are disclosed that have an inert water soluble polymeric component, biodegradable components, functional components reactive with chemical groups on a protein, for example, amine or thiol groups. The inert polymeric component may be fla...
05/03/2005
6875842Resinates from monomer
Reduced-rosin compositions of printing inks and the resinate binders therein, and the processes of preparation thereof, are described. In said compositions, a portion of the rosin normally used in the art is replaced by Monomer, and is further reacted with α,β-uns...
04/05/2005
6844420Natural resin formulations
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapors and char from biomass, ...
01/18/2005
6706858Use of alkanes for contamination-free purification or separation of biopolymers
The present invention relates to the use of alkanes for the contamination-free purification or separation of biopolymers. ...
03/16/2004
6555649Natural resin formulations
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapours and char fr...
04/29/2003
6476209Polynucleotides, materials incorporating them, and methods for using them
Novel polynucleotides isolated from Lactobacillus rhamnosus, as well as probes and primers, genetic constructs comprising the polynucleotides, biological materials, including plants, microorganisms and multicellular organisms incorporating the polynucleot...
11/05/2002
6433121Method of making natural oil-based polyols and polyurethanes therefrom
A method for making natural oil-based polyols directly from vegetable or animal oil using a consecutive two-step process involving epoxidation and hydroxylation is provided. Specifically, this process comprises adding a peroxyacid to a natural oil wherein...
08/13/2002
6326461Natural resin formulations
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast pyrolysis). Fast pyrolysis produces both vapors and char fro...
12/04/2001
6280724Composition and method for preserving progenitor cells
The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12-20 kD, or ...
08/28/2001
6228623Polyhydroxyalkanoates of narrow molecular weight distribution prepared in transgenic plants
Methods for the biosynthesis of polyhydroxyalkanoate homopolymers and copolymers are described. In a preferred embodiment, the polymers have a single mode molecular weight distribution, and more preferably have a distribution of between about 2 and about ...
05/08/2001
6146842High-throughput screening assays utilizing metal-chelate capture
A high throughput enzyme screen has been developed which relies on metal chelate interaction for capture of the product of the enzymatic reaction. In the present assay system, a detectable moiety is attached to a substrate having a chelating capturable mo...
11/14/2000
6084060Composition and method for preserving progenitor cells
The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD (SEQ ID NO:1) and a molecular weight of about 12-20 kD, or ...
07/04/2000
598146978 residue polypeptide (NK-lysine) and its use
A 78 residue polypeptide comprising the following amino acid sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKK PQAICVDIKICKE [SEQ ID NO:1]: and functional derivatives and pharmaceutically acceptab...
11/09/1999
5922324Propolis extract with improved water-solubility
A propolis extract which is prepared by adjusting the pH of propolis to 5.5-7.0 to improve the water-solubility of the effective ingredients of propolis, a composition containing the propolis extract, and a method for improving the water-solubility of pro...
07/13/1999
5821285Method of preparing filler containing forms of chitin
The method relates to the preparation of dry chitin forms of consistent shape that incorporates an advantageous additive such as fillers or reinforcement during the preparation process to give dry forms of chitin with consistent shape typically known as f...
10/13/1998
5703040Broad spectrum antibiotic peptide
Improved antimicrobial proteinaceous substances produced by Staphylococcus aureus KSI1829 (e.g., Bac1829) and methods of inhibiting microbial growth using such substances are disclosed....
12/30/1997
5698668Modified natural-resin acid esters, processes for their preparation, and their use as binder resins in printing inks
Toluene-soluble modified natural-resin acid esters which can be prepared by reacting at least one compound from each of the component groups: A) natural resins or natural-resin acids; B) ଱,ଲ-ethylenically unsaturated carboxylic acids or their ...
12/16/1997
5691154Enzyme linked immunoassay with stabilized polymer saccharide enzyme conjugates
An improvement in enzyme linked immunoassays is disclosed wherein the enzyme is in the form of a water soluble polymer saccharide conjugate which is stable in hostile environments. The conjugate comprises the enzyme which is linked to the polymer at multi...
11/25/1997
5621072Purified guaiacum resin and method for making same
A purified guaiacum resin which is obtained by isolation from a natural guaiacum resin with chromatography using a gel for reversed chromatography as a stationary phase and a polar solvent as a mobile phase. The purified guaiacum resin does not contain su...
04/15/1997
5556454Modified natural resin esters, processes for their preparation and their use as binder resins in printing inks
Toluene-soluble modified natural resin esters suitable as binder resins in ground pigments and printing inks for halftone gravure printing prepared by reacting at least one compound from each of the following substance groups A) to D) A) natural resins an...
09/17/1996
5492821Stabilized polyacrylic saccharide protein conjugates
This invention is directed to water soluble protein polymer conjugates which are stabile in hostile environments. The conjugate comprises a protein which is linked to an acrylic polymer at multiple points through saccharide linker groups....
02/20/1996
5157109Preparation of novel synthetic resins
A process for the preparation of novel resin comprising reacting cyclopentadienes, preferably dicyclopentadienes, with tall oil pitch or a neutrals-containing component thereof, at a temperature between about 200° C. and about 300° C. is described. The ...
10/20/1992
5130419Process for preparing lignocellulosic bodies
Process for preparing lignocellulosic bodies by bringing lignocellulosic parts into contact with a composition comprising a polyisocyanate, fumed silica and a non-ionic liquid gellant and by pressing this combinations of parts and composition. The adhesio...
07/14/1992
5049652Use of a mixed catalyst system to improve the viscosity stability of rosin resins
Rosin esters having improved viscosity stability are prepared by heating a mixture of rosin and a polyol in the presence of a catalyst mixture of 0.1% to 0.6% by weight calcium bis(ethyl 3,5-di-t-butyl-4-hydroxybenzyl phosphonate) and 0.02 to 1.0% by weig...
09/17/1991
4876331Copolyester and process for producing the same
According to the present invention, a novel copolyester comprising 3-hydroxybutyrate unit, 3-hydroxyvalerate unit and 5-hydroxyvalerate unit; 3-hydroxybutyrate unit and 4-hydroxybutyrate unit; or 3-hydroxybutyrate unit, 4-hydroxybutyrate unit and 3-hydrox...
10/24/1989
4806285Hydrogenated grindelia acids and their methyl, glycerol and pentaerythritol esters
Novel diterpene compounds are separated from dry biomass of Grindelia camporum. The separated compounds are then hydrogenated and esterified. Both the hydrogenated and ester products are useful as tackifiers....
02/21/1989
4382886Method for extracting propolis and water soluble dry propolis powder
A new and useful method for extracting propolis from substantially clean raw material to obtain a dry propolis powder. Depending upon the method employed, either a water soluble propolis powder or an organic soluble propolis powder may be obtained. A uniq...
05/10/1983
4297271Guaiaconic acid A from guaiac resin
The invention provides a diagnostic agent for the detection of occult blood in feces comprising hydrogen peroxide and, as a chromogen, guaiaconic acid A, optionally with a stabilizer. The invention provides, as a novel substance, guaiaconic acid A having ...
10/27/1981
 
Sign InRegister
Username  
Password   
forgot password?