Bizarre Patents
A small umbrella which may be removably attached to a beverage container in order to shade the beverage container from the direct rays of the sun.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 7807184 | Hybrid Shiga-like toxin The present invention relates to a hybrid bacterial toxin subunit, to a hybrid bipartite bacterial toxin and to nucleic acid molecules comprising a nucleotide sequence encoding such bacterial toxins. Furthermore, the invention relates to vaccines comprising bacteria... | 10/05/2010 |
| 7604811 | Oral-intestinal vaccines against diseases caused by enteropathic organisms using antigens encapsulated within biodegradable-biocompatible microspheres This invention is directed to oral-intestinal vaccines and their use against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres. ... | 10/20/2009 |
| 7575754 | Avian vaccine for protection against colibacillosis A genetic deletion mutant live E. coli vaccine suitable for mass application to poultry, including chickens, is provided. Also provided is a safe and effective method to protect poultry against the ravages of Escherichia coli bacillosis infection and d... | 08/18/2009 |
| 7527802 | Vaccine for transcutaneous immunization A vaccine delivered by transcutaneous immunization provides an effective treatment against infections by pathogens such as, for example, enterotoxigenic Escherichia coli (ETEC) and/or for symptoms of diarrheal disease caused thereby. For example, one, two, th... | 05/05/2009 |
| 7422752 | Mutant forms of EtxB and CtxB and their use as carriers The present invention describes the use of a mutant form of EtxB or CtxB to deliver an agent to a target cell wherein the mutant has GM-1 binding activity; but wherein the mutant has a reduced immunogenic and immunomodulatory activity relative to the wild type form ... | 09/09/2008 |
| 7404961 | Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ... | 07/29/2008 |
| 7399474 | Isolation and characterization of the operon (ETEC-CS4 pili) and methods of using same Compositions comprising products of the csa operon, an isolated nucleic acid encoding the csa operon or functional fragments thereof, purified polypeptide products of the csa operon or functional fragments thereof, methods of eliciting an immune response to these pr... | 07/15/2008 |
| 7393535 | Adjuvants for use in vaccines The invention relates to adjuvants that contain a lecithin, an oil and an amphiphilic surfactant and that are capable of forming a stable oil-in-water emulsion vaccine so as to minimize local reactions to the vaccine in the injected animal. ... | 07/01/2008 |
| 7384639 | Methods of treating or preventing an infectious disease using an immunogenic conjugate of a gram-negative bacterial autoinducer molecule The present invention relates to an immunogenic conjugate comprising a carrier molecule coupled to an autoinducer of a Gram negative bacteria The immunogenic conjugate, when combined with a pharmaceutically acceptable carrier, forms a suitable vaccine for mammals to... | 06/10/2008 |
| 7371393 | Methods for reducing fecal shedding The present invention provides methods for reducing shedding in an animal. Generally, the method includes administcriirn to an animal a composition including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide... | 05/13/2008 |
| 7357935 | Avian vaccine for protection against colibacillosis A genetic deletion mutant live E. coli vaccine suitable for mass application to poultry, including chickens, is provided. Also provided is a safe and effective method to protect poultry against the ravages of Escherichia coli bacillosis infection and d... | 04/15/2008 |
| 7341732 | Methods for treating mastitis in a milk producing animal The present invention provides methods for treating mastitis in a milk producing animal. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a concen... | 03/11/2008 |
| 7326769 | Method for isolating and purifying grass pollen allergens The invention relates to a method for quickly and effectively isolating and purifying five, namely the group 1, 2, 3, 10 and 13 allergens from grass pollen. The purification of said grass pollen is based on the inventive combination of hydrophobic interaction chroma... | 02/05/2008 |
| 7323179 | Methods and compositions for the treatment and prevention of and other bacterial infections The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in which a RAP-type and/or TRAP-type molecule plays a role in pathogenesis... | 01/29/2008 |
| 7320794 | Transporter protein A novel protein which has an activity to transport hydantoin compounds is described, as well as a recombinant expressing this transporter protein. From Microbacterium liquefaciens strain AJ3912, a novel gene was discovered to encode a protein which is able to... | 01/22/2008 |
| 7297338 | Avian vaccine composition for the protection of poultry against disease and infection caused by and Salmonella There is provided a vaccine composition comprising a combination of a genetic deletion mutant S. typhimurium microorganism and a genetic deletion mutant E. coli microorganism, suitable for mass application to poultry. Also provided is a safe and effect... | 11/20/2007 |
| 7291325 | Method for producing target proteins by deleting or amplifying and/or gene coding for inclusion body-associated proteins A method for producing target proteins by deleting or amplifying ibpA and/or ibpB genes coding for inclusion body-associated proteins. Two methods for producing target proteins using ibpA and/or ibpB genes coding for inclusion body-associated proteins of E. coli ... | 11/06/2007 |
| 7208574 | Host receptor for pathogenic bacteria A polypeptide, called Tir (for translocated intimin receptor, which is secreted by attaching and effacing pathogens, such as the enteropathogenic (EPEC) and enterohemorrhagic (EHEC) E. coli. These bacterial pathogens inserts their own receptors into mammalian... | 04/24/2007 |
| 7160549 | Methods for making compositions including gram negative microbial polypeptides The present invention provides methods for making compositions including siderophore receptor polypeptides and porins from gram negative microbes. The methods include providing a gram negative microbe, disrupting the microbe, solubilizing the disrupted microbe, and ... | 01/09/2007 |
| 7147857 | Methods for treating high somatic cell counts The present invention provides methods for treating an animal having a high somatic cell count. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a... | 12/12/2006 |
| 7138124 | Polypeptides obtained from gram negative microbes The present invention provides compositions including at least two siderophore receptor polypeptides and at least two porins from a gram negative microbe, and preferably, lipopolysaccharide at a concentration of no greater than about 10.0 endotoxin units per millili... | 11/21/2006 |
| 7138125 | Methods for treating an animal for low milk production The present invention provides methods for treating an animal for low milk production. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a concentr... | 11/21/2006 |
| 7118758 | Transformed bacteria producing CS6 antigens as vaccines Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof. ... | 10/10/2006 |
| 7070781 | Nontoxic mucosal adjuvant A non-toxic mucosal adjuvant is provided which may be admixed with further antigens to provide a vaccine administrable to mucosal surfaces in organisms including man. Preferably, the non-toxic mucosal adjuvant is a detoxified mutant of a bacterial ADP-ribosylating t... | 07/04/2006 |
| 7063852 | Hybrid LT-A/CT-B holotoxin for use as an adjuvant The present invention provides a novel composition which is a hybrid heat labile enterotoxin comprising the A-subunit of the heat labile toxin of Escherichia coli (LT-A) and the B-subunit of the cholera enterotoxin of Vibrio cholerae (CT-B). The hybrid... | 06/20/2006 |
| 7056521 | Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants The present invention provides parenteral adjuvants comprising detoxified mutants of bacterial ADP-ribosylating toxins, particularly those from pertussis (PT), cholera (CT), and heat-labile E. coli (LT). ... | 06/06/2006 |
| 7037510 | Hybrids of M. tuberculosis antigens The present invention discloses fusion proteins of the immunodominant antigens ESAT-6 and Ag85B from Mycobacterium tuberculosis or homologues thereof, and a tuberculosis vaccine based on the fusion proteins, which vaccine induces efficient immunological memor... | 05/02/2006 |
| 7025963 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 04/11/2006 |
| 7025971 | Treatment or prophylaxis of diseases caused by pilus-forming bacteria Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of th... | 04/11/2006 |
| 7018636 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 03/28/2006 |
| 6962791 | Treatment or prophylaxis of diseases caused by pilus-forming bacteria Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of th... | 11/08/2005 |
| 6942861 | Histidine-tagged intimin and methods of using intimin to stimulate an immune response and as an antigen carrier with targeting capability The present invention describes the isolation and purification of histidine-tagged functional portions of intimin (his-tagged intimin or his-intimin), a protein associated with the ability of certain strains of pathogenic bacteria to adhere to epithelial cells. The ... | 09/13/2005 |
| 6913753 | Incapacitated whole-cell immunogenic bacterial compositions The invention features incapacitated whole cell bacterial immunogenic compositions produced by infecting a bacterium with Lys minus bacteriophage, which are deficient in the lysin protein. Lys minus bacteriophage retain activity in infection of its appropriate bacte... | 07/05/2005 |
| 6905691 | Vaccines containing attenuated bacteria The invention relates to a vaccine comprising a bacterium attenuated by a non-reverting mutation in a gene encoding a protein which promotes folding of extracytoplasmic proteins. Such mutations were initially identified as being useful in vaccines from a bank of ran... | 06/14/2005 |
| 6902736 | Isolation and characterization of the csa operon (ETEC-CS4 pili) and methods of using same Compositions comprising products of the csa operon, an isolated nucleic acid encoding the csa operon or functional fragments thereof, purified polypeptide products of the csa operon or functional fragments thereof, methods of eliciting an immune response to these pr... | 06/07/2005 |
| 6872547 | Functional balanced-lethal host-vector systems The invention encompasses methods of maintaining desired recombinant genes in a genetic population of cells expressing the desired gene. The methods utilize microbial cells that have an inactivating mutation in a native essential gene encoding an enzyme which cataly... | 03/29/2005 |
| 6793928 | Vaccines with an LTB adjuvant The present invention relates to a vaccine containing at least one particulate immunogen and an adjuvanting amount of B subunits of heat-labile enterotoxin characteristic of E. Coli. More in particular, this invention relates to vaccines wherein the adjuvanti... | 09/21/2004 |
| 6743607 | Production of complex carbohydrates Compositions and methods for making complex carbohydrates in a bacterial production cell are disclosed. The complex carbohydrates that can be made include oligosaccharides and polysaccharides of bacterial or mammalian origin. ... | 06/01/2004 |
| 6737063 | FimH adhesin proteins and methods of use The present invention provides bacterial immunogenic agents for administration to humans and non-human animals to stimulate an immune response. Also provided are methods for vaccination of mammalian species, especially human patients, with variants of the E. coli... | 05/18/2004 |
| 6638513 | Neisseria meningitidis serogroup B Glycoconjugates The present invention pertains generally to Neisseria meningitidis serogroup B glycoconjugates. More particularly, the invention pertains to glycoconjugates formed from a Neisseria meningitidis serogroup B capsular oligosaccharide derivative (MenB OS deri... | 10/28/2003 |
