Quotables
"One of the greatest labor saving inventions of today is tomorrow!"
Vincent T. Floss
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 8110197 | Mutated heat-labile enterotoxin This invention relates to a mutant E. coli heat-labile enterotoxin (LT) subunit A that can be used as an adjuvant. This subunit A mutant contains an amino acid substitution at a position corresponding to position 61 of a wild-type LT. An LT containing this mu... | 02/07/2012 |
| 8088394 | Mutated heat-labile enterotoxin This invention relates to a mutant E. coli heat-labile enterotoxin (LT) subunit A that can be used as an adjuvant. This subunit A mutant contains an amino acid substitution at a position corresponding to position 61 of a wild-type LT. An LT containing this mu... | 01/03/2012 |
| 8062644 | Immunogens from uropathogenic Disclosed herein are various genes that can be included in immunogenic compositions specific for pathogenic E. coli strains. The genes are from uropathogenic strains but are absent from non-pathogenic strains, and their encoded proteins have cellular location... | 11/22/2011 |
| 7820184 | Methods and compositions for detection of microorganisms and cells and treatment of diseases and disorders Methods for detecting a microorganism or cell in a subject and methods for detecting, imaging or diagnosing a site, disease, disorder or condition in a subject using microorganisms or cells and methods that microorganisms or cells for treating a disease, disorder or... | 10/26/2010 |
| 7722887 | Detoxified mutants of heat-labile enterotoxin The present invention relates to detoxified and immunologically active proteins (“mutant LTs”) having mutated amino acid sequences of heat-labile enterotoxin of E. coli, DNA sequences encoding the mutant LTs, recombinant expression vectors comprising the ... | 05/25/2010 |
| 7666437 | Intranasal vaccine for use against disease caused by enterotoxigenic The disclosure relates to an intranasal peptide vaccine for use against infection caused by enterotoxigenic Escherichia coli (ETEC), containing a common linear protein epitope known as CLE which is recognized by sera of patients infected with the bacteria and... | 02/23/2010 |
| 7625571 | Transformed bacteria producing CS6 antigens as vaccines Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof. ... | 12/01/2009 |
| 7422752 | Mutant forms of EtxB and CtxB and their use as carriers The present invention describes the use of a mutant form of EtxB or CtxB to deliver an agent to a target cell wherein the mutant has GM-1 binding activity; but wherein the mutant has a reduced immunogenic and immunomodulatory activity relative to the wild type form ... | 09/09/2008 |
| 7404961 | Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ... | 07/29/2008 |
| 7371393 | Methods for reducing fecal shedding The present invention provides methods for reducing shedding in an animal. Generally, the method includes administcriirn to an animal a composition including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide... | 05/13/2008 |
| 7341732 | Methods for treating mastitis in a milk producing animal The present invention provides methods for treating mastitis in a milk producing animal. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a concen... | 03/11/2008 |
| 7332172 | Transformed bacteria producing CS6 antigens as vaccines Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof. ... | 02/19/2008 |
| 7323179 | Methods and compositions for the treatment and prevention of and other bacterial infections The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in which a RAP-type and/or TRAP-type molecule plays a role in pathogenesis... | 01/29/2008 |
| 7309493 | Inactivated bovine scours vaccines, process and method of preventing bovine scours Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of at least one inactivated viral strain are described. Polyvalent inacti... | 12/18/2007 |
| 7247307 | Vaccines against O157 infection This invention relates to conjugates of the O-specific polysaccharide of E. coli O157 with a carrier, and compositions thereof, and to methods of using of these conjugates and/or compositions thereof for eliciting an immunogenic response in mammals, including... | 07/24/2007 |
| 7217541 | Method of making CS6 antigen vaccine for treating, preventing, or inhibiting enterotoxigenic infections Disclosed herein are methods for making large amounts of highly pure colonization factors. The methods of the present invention differ from prior art methods in that host cells which express the colonization factor of interest are cultured in media comprising more t... | 05/15/2007 |
| 7214499 | Pathogenic associated protein The present invention provides a polypeptide, called EspA, which is secreted by pathogenic E. coli, such as the enteropathogenic (SPEC) and enterohemorrhagic (EHEC) E. coli. The invention also provides isolated nucleic acid sequences encoding EspA poly... | 05/08/2007 |
| 7189557 | Process for the intracellular over-production of streptokinase using genetically engineered strain of An improved process for the production of streptokinase using a genetically engineered strain of Escherichia coli which overproduces streptokinase intracellularly and more particularly, the overall process disclosed herein, concerns with an improvement in the... | 03/13/2007 |
| 7160549 | Methods for making compositions including gram negative microbial polypeptides The present invention provides methods for making compositions including siderophore receptor polypeptides and porins from gram negative microbes. The methods include providing a gram negative microbe, disrupting the microbe, solubilizing the disrupted microbe, and ... | 01/09/2007 |
| 7147857 | Methods for treating high somatic cell counts The present invention provides methods for treating an animal having a high somatic cell count. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a... | 12/12/2006 |
| 7138125 | Methods for treating an animal for low milk production The present invention provides methods for treating an animal for low milk production. The methods include administering compositions including siderophore receptor polypeptides and porins from gram negative microbes, and preferably, lipopolysaccarhide at a concentr... | 11/21/2006 |
| 7138124 | Polypeptides obtained from gram negative microbes The present invention provides compositions including at least two siderophore receptor polypeptides and at least two porins from a gram negative microbe, and preferably, lipopolysaccharide at a concentration of no greater than about 10.0 endotoxin units per millili... | 11/21/2006 |
| 7118758 | Transformed bacteria producing CS6 antigens as vaccines Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof. ... | 10/10/2006 |
| 7094438 | Frozen concentrated liquid whole egg and method of making same The invention is directed to a frozen concentrated liquid whole egg product and a process for making the frozen concentrated product. The product has from about 33 to about 49 weight solids, from about 51 to about 67 weight percent water and a viscosity at 40° F. o... | 08/22/2006 |
| 7094883 | Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to th... | 08/22/2006 |
| 7056521 | Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants The present invention provides parenteral adjuvants comprising detoxified mutants of bacterial ADP-ribosylating toxins, particularly those from pertussis (PT), cholera (CT), and heat-labile E. coli (LT). ... | 06/06/2006 |
| 7037499 | Adjuvant for transcutaneous immunization A transcutaneous immunization system delivers antigen to immune cells without perforation of the skin, and induces an immune response in an animal or human. The system uses an adjuvant, preferably an ADP-ribosylating exotoxin, to induce an antigen-specific immune re... | 05/02/2006 |
| 7025971 | Treatment or prophylaxis of diseases caused by pilus-forming bacteria Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of th... | 04/11/2006 |
| 7018636 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 03/28/2006 |
| 7014857 | Anti-sepsis conjugate vaccine The present invention provides an immunogenic conjugate comprising biologically deacylated gram-negative bacterial moieties linked to D. discoideum proteinase 1, as well as novel subunits thereof, and methods of making and using the conjugates in vaccines to ... | 03/21/2006 |
| 6974577 | Inactivated bovine scours vaccines, processes and method of preventing bovine scours Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of at least one inactivated viral strain are described. Polyvalent inacti... | 12/13/2005 |
| 6962791 | Treatment or prophylaxis of diseases caused by pilus-forming bacteria Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of th... | 11/08/2005 |
| 6951652 | Vaccine for prevention of gram-negative bacterial infections and endotoxin related diseases A vaccine is disclosed which is useful for protecting a host from Gram negative infections and the effects of endotoxin, therefore preventing sepsis and septic shock. The vaccine is prepared by combining LPS free or in conjugate form with a stoichiometric excess of ... | 10/04/2005 |
| 6942861 | Histidine-tagged intimin and methods of using intimin to stimulate an immune response and as an antigen carrier with targeting capability The present invention describes the isolation and purification of histidine-tagged functional portions of intimin (his-tagged intimin or his-intimin), a protein associated with the ability of certain strains of pathogenic bacteria to adhere to epithelial cells. The ... | 09/13/2005 |
| 6872542 | Treatment or prophylaxis of diseases caused by pilus-forming bacteria Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of th... | 03/29/2005 |
| 6844423 | Compositions and methods for regulating bacterial pathogenesis The production of a purified extracellular bacterial signal called autoinducer-2 is regulated by changes in environmental conditions associated with a shift from a free-living existence to a colonizing or pathogenic existence in a host organism. Autoinducer-2 stimul... | 01/18/2005 |
| 6841345 | Treatment and prevention of immunodeficiency virus infection by administration of non-pyrogenic derivatives of lipid A The present inventors have found that certain preparations containing LPS and/or lipid A variants, derivatives, and/or analogs demonstrate non-pyrogenic properties and exhibit anti-viral activities. In particular, non-pyrogenic preparations of LPS, lipid A, LPS anta... | 01/11/2005 |
| 6835710 | Verotoxin pharmaceutical compositions and medical treatments therewith Pharmaceutical compositions comprising known verotoxins, particularly, verotoxin 1, have been found to be useful in the treatment of mammalian neoplasia, particularly, ovarian cancer and skin cancer. Surprisingly, although verotoxin 1 has previously been shown to ha... | 12/28/2004 |
| 6833451 | Lipopolysaccharides (LPS) extracted from Escherichia coli Lipopolysaccharides and processes for producting the lipopolysaccharides are provided. The lipopolysaccharide has a lipid A portion, a core oligosaccharide portion, and an O-specific chain having a single repeating unit 06. A lipopolysaccharide may be produced by wa... | 12/21/2004 |
| 6824997 | Process and materials for the rapid detection of streptococcus pneumoniae employing purified antigen-specific antibodies A process is disclosed for obtaining a C-polysaccharide cell wall antigen containing not more than about 10% protein from Streptococcus pneumoniae bacteria. The antigen thus obtained is conjugated to a spacer molecule, and the free end of the latter is then c... | 11/30/2004 |
