Did You Know...
...that in the early 1940s GE engineer James Wright was charged with a task of utmost importance to the war effort: develop a cheap substitute for rubber that could be used to produce tires, gas masks and a whole host of military gear. Wright tackled the task diligently -- and wound up inventing Silly Putty.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 8173130 | Antibodies against flagellin and uses thereof The present invention provides a novel class of monoclonal antibodies which have a high affinity, broad spectrum neutralizing reactivity to flagellin from various Gram-negative bacteria including, but not limited to, E. coli, Salmonella, Serratia, Proteus, Entero... | 05/08/2012 |
| 8071100 | Monoclonal antibodies that neutralize anthrax toxins The present invention relates to monoclonal antibodies that bind or neutralize anthrax lethal factor (LF), edema factor (EF), and/or protective antigen (PA). The invention provides such antibodies, fragments of such antibodies retaining anthrax toxin-binding ability... | 12/06/2011 |
| 8067004 | Surface antigen The invention provides a novel surface polypeptide from Neisseria meningitidis as well as nucleic acid and nucleic acid sequence homologues encoding this protein. Pharmaceutical compositions containing the polypeptide and nucleic acids of the invention are al... | 11/29/2011 |
| 7985410 | Method or agent for inhibiting the function of efflux pump The purpose of the present invention is to provide a method and an agent to efficiently inhibit the function of the drug efflux pump of Pseudomonas aeruginosa. The invention provides a method to inhibit the function of the drug efflux pump of Pseudomonas a... | 07/26/2011 |
| 7597893 | Human monoclonal antibody specific lipopolysaccharides (LPS) of serotype IATS 06 of The present application relates to a human monoclonal antibody specific for the serotype IATS 06 of P. aeruginosa, a hybridoma producing it, nucleic acids encoding it, and host cells transfected therewith. Further, the present invention relates to methods for... | 10/06/2009 |
| 7588762 | Streptoccal inhibitor of complement-mediated lysis, protein SIC A protein from Streptococcus pyogenes, serotype Ml has been characterized. This protein, called protein SIC, plays a role in S. pyogenes pathogenicity and virulence. It inhibits hemolysis by interacting with the plasma proteins clusterin, and members o... | 09/15/2009 |
| 7442373 | Antibodies against protective antigen and methods of use for passive immunization and treatment of anthrax A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax tox... | 10/28/2008 |
| 7438909 | Immunization and treatment methods for anthrax A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax tox... | 10/21/2008 |
| 7429381 | Production and use of novel peptide-based agents for use with bi-specific antibodies The present invention relates to a bi-specific antibody or antibody fragment having at least one arm that is reactive against a targeted tissue and at least one other arm that is reactive against a linker moiety. The linker moiety encompasses a hapten to which antib... | 09/30/2008 |
| 7390626 | Methods and kit for diagnosing tick borne illnesses ELISA, Western Blot, and a peptide-based ELISA were applied to clinical specimens from patients with clinical symptoms of tick borne diseases, including Lyme disease. Peptides from different components of Borrelia during different cycles, including peptides f... | 06/24/2008 |
| 7390489 | Monoclonal antibody selectively recognizing listeria monocytogenes, hybridoma producing the antibody, test kit comprising the antibody and detection method of listeria monocytogenes using the antibody The present invention relates to a monoclonal antibody binding specifically to the p60 protein of Listeria monocytogenes, a hybridoma cell producing the monoclonal antibody, a test kit comprising the monoclonal antibody, and a method for detecting Listeria... | 06/24/2008 |
| 7368112 | fibrinogen binding protein gene The isolation of genes and proteins from Staphylococcus aureus is provided, and the nucleic acids coding for specific regions of the S. aureus CIfA protein are described. The nucleic acids encode proteins that can be useful as vaccines or in pharmaceut... | 05/06/2008 |
| 7364738 | Monoclonal antibodies to the CLFA protein and method of use in treating infections Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus, including the active fragments proteins from its fibrinogen binding domain such as Clf... | 04/29/2008 |
| 7354577 | Common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) and uses thereof A novel protein Common Lymphatic Endothelial and Vascular Endothelial Receptor-1 (CLEVER-1) is described. CLEVER-1 mediates leukocyte and malignant cell binding to vascular and lymphoid endothelial cells. CLEVER-1 is the first protein that has been reported to media... | 04/08/2008 |
| 7326419 | Surface protein of The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods. ... | 02/05/2008 |
| 7291334 | Antibodies to novel proteins in enteroaggregative (EAEC) useful for diagnosis and therapy of EAEC infections Novel proteins and their corresponding nucleotide sequences in enteroaggregative Escherichia coli (EAEC) are provided. In particular, Aap and the five gene cluster (aat) of the AA probe region of the pAA plasmid of EAEC 042 have been identified, sequenced, an... | 11/06/2007 |
| 7288637 | Single chain antibody against mutant p53 More than 90% of mutations found in the p53 protein produce a conformational change in p53 which results in the exposure of an epitope, which is otherwise hidden in the hydrophobic core of the molecule. A single chain antibody (scFv) which specifically recognizes th... | 10/30/2007 |
| 7285646 | Ultrapure transferrin for pharmaceutical compositions The present invention relates to an ultrapure human transferrin, and to methods for manufacturing the ultrapure transferrin. The transferrin may be holo-, apo- or at any desired degree of iron saturation. The invention further relates to the use of ultrapure transfe... | 10/23/2007 |
| 7276240 | Antibodies to novel proteins in enteroaggregative (EAEC) useful for diagnosis and therapy of EAEC infections Novel proteins and their corresponding nucleotide sequences in enteroaggregative Escherichia coli (EAEC) are provided. In particular, Aap and the five gene cluster (aat) of the AA probe region of the pAA plasmid of EAEC 042 have been identified, sequenced, an... | 10/02/2007 |
| 7250494 | Opsonic monoclonal and chimeric antibodies specific for lipoteichoic acid of Gram positive bacteria The present invention encompasses monoclonal antibodies that bind to lipoteichoic acid (LTA) of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro. The invention also provides antibodies h... | 07/31/2007 |
| 7241592 | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use Antibodies to the CNA protein and to other regions from the collagen binding domain, including domain CNA19, are provided, and antibodies produced in this manner have been shown to be cross reactive to both Staphylococcus aureus and Staphylococcus epidermi... | 07/10/2007 |
| 7238677 | Prevention of urogenital infections The invention provides hyaluronic acid compounds and derivatives thereof for preventing urogenital infections by a variety of pathogens, as well as compositions, articles and methods for treating and preventing urogenital infections. ... | 07/03/2007 |
| 7230087 | mucoid exopolysaccharide specific binding peptides The present invention relates to peptides, particularly human monoclonal antibodies, that bind specifically to P. aeruginosa mucoid exopolysaccharide. The invention further provides methods for using these peptides in the diagnosis, prophylaxis and therapy of... | 06/12/2007 |
| 7195763 | Surface proteins from gram-positive bacteria having highly conserved motifs and antibodies that recognize them Isolated peptide sequences and proteins containing these sequences are provided which are useful in the prevention and treatment of infection caused by Gram-positive bacteria. The peptide sequences have been shown to be highly conserved motifs in the surface protein... | 03/27/2007 |
| 7189405 | Peptide mimics of conserved gonococcal epitopes and methods and compositions using them The present invention relates to peptide mimics of a conserved gonococcal epitope of Neisseria gonorrhoeae, which epitope is not found on human blood group antigens. This invention also relates to methods and compositions using such peptide mimics for the pro... | 03/13/2007 |
| 7183083 | Nucleic acid and amino acid sequences relating to for diagnostics and therapeutics The invention provides isolated polypeptide and nucleic acid sequences derived from Staphylococcus epidermidis that are useful in diagnosis and therapy of pathological conditions; antibodies against the polypeptides; and methods for the production of the poly... | 02/27/2007 |
| 7169392 | serogroup B glycoconjugates and methods of producing the same The present invention pertains generally to novel Neisseria meningitidis serogroup B glycoconjugates. More particularly, the invention pertains to glycoconjugates formed from a Neisseria meningitidis serogroup B capsular oligosaccharide derivative (Men... | 01/30/2007 |
| 7160990 | Antibodies to a fibrinogen binding protein of staphylococcus epidermidis A new fibrinogen binding protein or polypeptide originating from coagulase negative staphylococci, biotechnological methods for producing the protein or polypeptide having fibrinogen binding activity and a recombinant DNA molecule coding for the protein (or f... | 01/09/2007 |
| 7160548 | strains with modified erp gene and vaccine composition containing same Mycobacterium strains in which the erp gene is modified, and vaccine compositions comprising such Mycobacterium strains are provided. The modification of the erp gene may decrease the virulence and the persistence of the Mycobacterium strains. | 01/09/2007 |
| 7157562 | Bioprocess for the production of recombinant anti-botulinum toxin antibody A process for producing recombinant anti-botulinum toxin antibody comprising the steps of fermenting recombinant E. Coli cells in broth, concentrating the cells by removing the broth, crushing the concentrated cells, separating a permeate derived from the cru... | 01/02/2007 |
| 7157088 | Surface protein of The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods. ... | 01/02/2007 |
| 7122196 | Compounds and methods for diagnosis of tuberculosis Compounds and methods for diagnosing tuberculosis are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of one or more M. tuberculosis proteins, and DNA sequences encoding such polypeptides. Diagnostic kits con... | 10/17/2006 |
| 7115264 | Monoclonal antibodies to the fibronectin binding protein and method of use in treating or preventing infections Monoclonal antibodies which can bind to the Fnbp protein of Staphylococcus aureus and which are generated from a peptide from the D2 region of fibronectin binding protein B (Fnbp) of S. aureus are provided which can be useful in the treatment and prote... | 10/03/2006 |
| 7115268 | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock This invention relates to compositions and methods which provide protection against, or reduce the severity of toxic shock and septic shock from bacterial infections. More particularly it relates to peptides derived from homologous sequences of the family of staphyl... | 10/03/2006 |
| 7108853 | Surface protein of Leptospira The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods. ... | 09/19/2006 |
| 7108854 | Surface proteins of The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods. ... | 09/19/2006 |
| 7105170 | Latent human tuberculosis model, diagnostic antigens, and methods of use Provided herein is an in vitro granuloma model and methods of its use. Methods of detecting and/or diagnosing latent tuberculosis in a subject are also provided, as are latency-specific antigens (and antibodies thereto), such as α-crystallin, and methods of identif... | 09/12/2006 |
| 7105317 | Immunogenic compositions comprising vrg-gene products from extracts This invention relates to an immunogenic composition comprising a bacterial extract containing at least one expression products of the vrg genes of a strain of Bordetella chosen from B. pertussis, B. parapertussis, or B. bronchiseptica. The inve... | 09/12/2006 |
| 7094883 | Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to th... | 08/22/2006 |
| 7094403 | superoxide dismutase The invention relates to Mycobacterium tuberculosis superoxide dismutase antibodies, methods of using them for detection of M. tuberculosis, methods of testing for an inhibitor of an M. tuberculosis superoxide dismutase, and methods of detecting... | 08/22/2006 |
