Bizarre Patents
Crispy Chip Sandwich and Process of Producing a Sandwich Product
A food product comprising a multilayer cookie or snack having outer layers formed from a crispy type edible food product such as a potato chip or corn chip, etc. with an intermediate marshmallow layer being in contact with the inner surface of each crispy chip and one or more filler substances.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 7094883 | Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to th... | 08/22/2006 |
| 7045336 | Bacterial delivery system We describe a bacterial delivery system for the delivery of DNA and antigens into cells. We constructed an attenuated bacterial vector which enters mammalian cells and ruptures delivering functional plasmid DNA and antigens into the cell cytoplasm. This Shigella ... | 05/16/2006 |
| 7025963 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 04/11/2006 |
| 7018636 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 03/28/2006 |
| 6902743 | Therapeutic treatment and prevention of infections with a bioactive material(s) encapuslated within a biodegradable-bio-compatable polymeric matrix Novel burst-free, sustained release biocompatible and biodegrable microcapsules which can be programmed to release their active core for variable durations ranging from 1-100 days in an aqueous physiological environment. The microcapsules are comprised of a core of ... | 06/07/2005 |
| 6713284 | Bacterial superantigen vaccines The present invention relates to genetically attenuated superantigen toxin vaccines altered such that superantigen attributes are absent, however the superantigen is effectively recognized and an appropriate immune response is produced. The attenuated superantigen t... | 03/30/2004 |
| 6165307 | Multi-component 3-dimensional energetics method and construction A multi-component three dimensional energetic device and the method of maacturing it. The method includes the steps of forming a quantity of an energetic material into a plurality of sheets having relatively no appreciable thickness, and then cutting at ... | 12/26/2000 |
| 6036794 | Igniter composition An igniter composition, and a method of manufacturing the igniter composin, comprised of an oxidizer dispersed in polyurethane resin using anhydrous acetone as a solvent. The polyurethane resin is cured at room temperature and granulated to form a granul... | 03/14/2000 |
| 5698416 | Methods for production of antigens under control of temperature-regulated promotors in enteric bacteria Production of proteins in bacteria containing DNA sequences encoding proteins under the control of a temperature-regulated promotor is improved by growing the organisms at temperatures of less than 35° C. until the late logarithmic phase. Thereafter the ... | 12/16/1997 |
| 5695750 | Compositions for use to deactivate organophosphates A method of detoxifying organophosphates using mutant cholinesterase which esists aging. The addition of oximes to the cholinesterase further retards aging of the cholinesterase.... | 12/09/1997 |
| 5682882 | Vigilance monitor system This invention includes a plurality of ambient sensors at least one human subject stimulator, at least one sensor adapted to detect the human subject response to the stimuli, and a controller programmed to receive information from the environmental or amb... | 11/04/1997 |
| 5660854 | Drug releasing surgical implant or dressing material A surgical implant or external wound dressing which functions as both a hemostat and a device to safely and effectively deliver any of a number of pharmaceuticals to targeted tissue at a controlled rate is disclosed. The device generally comprises a carri... | 08/26/1997 |
| 5631283 | Use of sialic acid or antibodies to sialidase as anti-infectious agents and anti-inflammatory agents The administration of sialidase inhibitors or sialic acid is useful as me for treating inflammatory conditions and for intervening in infectious processes in instances where pathogenicity of the disease-causing organism is increased by microbial surface ... | 05/20/1997 |
| 5626151 | Transportable life support system A transportable life support system is for use in a battlefield and mass ualty situations and includes a base, a stretcher and a canopy. The base incorporates medical equipment that includes a ventilator, an oxygen source, an environmental control unit, ... | 05/06/1997 |
| 5626844 | Monoclonal antibody against ricin A chain Monoclonal antibodies against the A chain of ricin have been found to be ective in protecting mammals from morbidity arising from exposure to ricin toxin. The neutralizing action of the antibodies does not appear to be mediated by complement or by immuno... | 05/06/1997 |
| 5614193 | Hantavirus vaccine Vaccine formulations for inducing protective immune response to Hantaviruses in humans are disclosed. These formulations include an attenuated vaccinia virus vector containing cDNA's encoding Hantavirus nucleocapsid N protein, G1 and G2 glycoproteins. Met... | 03/25/1997 |
| 5607979 | Topical skin protectants Creams formed from about 35% to about 50% fine particulates of certain poly(tetrafluoroethylene) (PTFE) resins dispersed in perfluorinated polyether oils having viscosities from about 20 cSt to about 350 cSt afford good protection against chemical warfare... | 03/04/1997 |
| 5415532 | High effieciency balanced oscillating shuttle pump A pump and a method for pumping liquid or fluid through a pair resilient es includes a shuttle block which partially compresses the tubes in a balanced, alternating manner. The resilient tubes are held in a parallel relationship with a predetermined spac... | 05/16/1995 |
| 5025371 | Overload protected rack and pinion drive for an optical scanning device A slide (19) is driven by a gear mechanism (21) to position a scanning device (15) in a radial direction relative to the record carrier between an innermost track 3) and an outermost track (4), a stop (38) of the slide (19) abutting against a fixed stop (... | 06/18/1991 |
| 5014254 | Magneto-optical recording method and magneto-optical recording apparatus A method and apparatus are revealed for recording information on a record carrier (1) having a magneto-optical recording layer (2), a pattern of magnetic domains (23, 24) having a first and a second direction of magnetization being formed in the recording... | 05/07/1991 |
| 5005206 | Method of and arrangement for image data compression by means of a neural network Method of and arrangement for image data compression by vector quantization in accordance with a precoding in blocks, thereafter comparing by means of a neural network precoded blocks with reference words stored in the form of a code book so as to transmi... | 04/02/1991 |
| 5003391 | Circuitry for processing a synchronizing signal Circuitry for processing, in a television signal, a first, low-frequency synchronizing signal on which a second, high-frequency synchronizing signal is superposed, for supplying standardized television signal capable of being processed by a customary tele... | 03/26/1991 |
| 4999825 | Recording/reading apparatus for inscribable record carrier and its manufacture A record carrier (1) in the form of a disc-shaped carrier provided with a radiation-sensitive layer (6) having a servo track (4). The servo track produces track modulation by having a radial wobble, or lateral periodic deviation whose frequency is modulat... | 03/12/1991 |
| 4962493 | Record carrier with a follow-on track and apparatus for recording information thereon An apparatus for recording information on a disk-shaped record carrier body by a beam of radiation. The carrier body comprises a diffractive follow-on track which is capable of being scanned with an opto-electronic system so as to produce an electrical si... | 10/09/1990 |
| 4949332 | Optical record carrier having contrast enhancing information and servo-tracks An inscribable record carrier (1) is described, which comprises a previously recorded servo-track structure provided with a recording layer. The contrast between the servo-tracks (3) provided with information areas and the intermediate tracks (5) is incre... | 08/14/1990 |
| 4937646 | MOSFET with temperature protection On the semiconductor body of a MOSFET (1), the semiconductor body of a thyristor (5) (or of a bipolar transistor) is located for thermal conduction purposes. The anode and cathode terminals (A, K) (emitter and collector terminal) are connected to the gate... | 06/26/1990 |
| 4933923 | Optical record carrier inscribed with read-out control data and apparatus for reading such record carrier in conformity with such control data An optical record carrier having an information recording track which is inscribed with control data indicative of the change in average level of read-out signals from recorded and unrecorded portions of the track. Read apparatus for such record carrier s... | 06/12/1990 |
| 4922478 | Device for supporting a sub-frame of a disc record player on a frame, and disc record player comprising such a device Supporting elements (10) arranged between the frame and the sub-frame (1) for damp vibrations or shocks exerted on the sub-frame via the frame. The sub-frame (1) carries part including a turn-table (3) and a pivotal scanning arm (4) with a scanning elemen... | 05/01/1990 |
| 4917500 | Color sensor system for the recognition of objects with colored surfaces The color sensor system has at least three electronic light transmitters each emitting light of a determined narrow-band range of wavelengths, which under the control of a transmission control device in the course of a control cycle, illuminate successive... | 04/17/1990 |
| 4911776 | Method of manufacturing a mold for an optically readable information disc A mold is manufactured using a substrate and hub also used in the manufacture of the disc. A structure carrier provided with a mold structure is detachably connected to a substrate, and the mold structure is then centered relative to the central recess of... | 03/27/1990 |
| 4910624 | Optically readable disk with self centering hub Information carrier includes an optically readable disc with a center hole and a hub with radially resilient clamping members which extend through the center hole to retain it on the disc and center it with respect to the information carrying surface on t... | 03/20/1990 |
| 4907534 | Gas distributor for OMVPE Growth A new gas distributor 31 provides an extremely uniform gas across a wide cross section distance. An OMVPE reactor equipped with this distributor, a unique low volume quartz insert, a load-locked growth chamber and a low pressure operation scheme provide a... | 03/13/1990 |
| 4904617 | Method for separating monolithically produced laser diodes A method for separating laser diodes. The diodes are monolithically produced from a semiconductor substrate wafer which through an epitaxy process has been provided with a layer sequence suitable for laser operation. First, the semiconductor substrate waf... | 02/27/1990 |
| 4902091 | Light waveguide feedthrough for optoelectronic modules and method for their manufacture With a light waveguide feedthrough for optoelectronic modules a light waveguide fiber (1) is guided hermetically tight and mechanically stable, in particular long-term stable, directly through a module housing wall. The light waveguide fiber (1) is compre... | 02/20/1990 |
| 4900887 | Floating zone drawing circuitry for semiconductor rods For floating zone drawing of semiconductor rods having diameters greater than 100 mm, at the beginning of the zone drawing process, in particular during melting on of the seed crystal to the semiconductor rod to be drawn, a high load change and impedance ... | 02/13/1990 |
| 4900954 | Mixed CML/ECL macro circuitry A circuit technique is presented for mixing current mode logic and emitter coupled logic in a manner which reduces active and passive component counts for performing recognized logic functions. The reduced counts permit greater circuit density while reduc... | 02/13/1990 |
| 4898447 | Optoelectronic coupling system An optoelectronic coupling arrangement for a light waveguide cable (3), at each of whose ends an optoelectronic transmitter and/or receiver structural unit (1, 2) are optically coupled to, permit a signal or data transmission to or from an arbitrarily rot... | 02/06/1990 |
| 4897615 | High efficiency amplifier Amplifiers operating in push-pull are implemented to obviate input baluns and output signal combiners and their attendant losses. Amplifiers having two signal branches that each receive the input signal and have their signal branch outputs connected direc... | 01/30/1990 |
| 4896061 | GaAs analog switch cell with wide linear dynamic range from DC to GHz Improved series and shunt switching cells for selectively switching an RF input signal to an output over a wide range of frequencies and in a linear manner. The series cell includes an input FET which has the source electrode clamped by means of a diode c... | 01/23/1990 |
| 4896374 | Broadband monolithic balanced mixer apparatus A broadband monolithic balanced mixer employs a unidirectional active 180° hybrid. The hybrid is fabricated utilizing two active signal splitters, two all pass phase shifting networks and two active signal combiners. The all pass networks provide a contr... | 01/23/1990 |
