Celebrity Inventors
Glam girl Heddy Lamar may have used her good looks to good effect on the silver screen, but she put her smarts to better use as an inventor. During World War II, she co-patented a frequency-switching system for torpedo guidance that was considered years ahead of its time.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 6919311 | Factor VII polypeptide having factor VII:C activity Factor VIII polypeptides having FVIII:C activity that contain modifications in the A3 and/or C1 and/or C2 domains of the sequence of the light chain of Factor VIII, characterized by the binding affinity to low density lipoprotein receptor protein, and methods for pr... | 07/19/2005 |
| 6901927 | Methods and devices for use in performing pulmonary procedures An implantable flow control element is provided which prevents air from entering an isolated portion of a patient's lung. The element may permit air to escape from the isolated portion so that the element acts like a valve. Systems for implanting pulmonary devices a... | 06/07/2005 |
| 6901084 | Stable solid state raman laser and a method of operating same The present invention relates to a stable solid-state Raman laser, the solid-state Raman laser including a resonator cavity defined by at least two reflectors, a laser material located in the resonator cavity and capable of generating a cavity laser beam which propa... | 05/31/2005 |
| 6891876 | Method and apparatus for polarization and wavelength insensitive pumping of solid state lasers An optical system has a diode pump source, and a gain media made of a material with an anisotropic absorption. The gain media is cut at an angle to produce substantially polarization-independent absorption of a pump beam. An optical coupler is positioned between the... | 05/10/2005 |
| 6872550 | Immunogenic formulation of OspC antigen vaccines for the prevention and treatment of lyme disease and recombinant methods for the preparation of such antigens A novel approach to Borrelia vaccine formulation taking into account serological, genotypic and epidemiological information by which OspC proteins from different strains of B. burgdorferi are grouped together. OspC antigens are chosen in order to constitute a... | 03/29/2005 |
| 6858864 | Devices with optical gain in silicon A photonic device includes a silicon semiconductor based superlattice. The superlattice has a plurality of layers that form a plurality of repeating units. At least one of the layers in the repeating unit is an optically active layer with at least one species of rar... | 02/22/2005 |
| 6855661 | Catalyst for purification of diesel engine exhaust gas This invention provides a new catalyst for purification of diesel engine exhaust gas comprising a carrier of at least one sulfur-resistant refractory oxide and at least one catalytic metal, wherein at least one solid acid and/or sulfuric acid is carried on the carri... | 02/15/2005 |
| 6853655 | System for improved power control A laser system includes a pump source that produces a first output. The pump source has a feedback loop with a first summing junction and a first command that has step quantization or digitized set point. An output device is coupled to the pump source to receive the... | 02/08/2005 |
| 6852772 | High modulus crosslinked polyethylene with reduced residual free radical concentration prepared below the melt The present invention provides an irradiated crosslinked polyethylene containing reduced free radicals, preferably containing substantially no residual free radical. Disclosed is a process of making irradiated crosslinked polyethylene by irradiating the polyethylene... | 02/08/2005 |
| 6850896 | Method and system for managing and providing sales data using world wide web A method and system for managing sales data. One embodiment is a software application that assists in classification, review and approval of data to be stored in a database for the use of a product supplier or seller. In one embodiment, a method includes storing a p... | 02/01/2005 |
| 6842884 | Combinational equivalence checking methods and systems with internal don't cares An equivalence checking method provides first and second logic functions. Don't care gates are inserted for don't care conditions in the first and second logic functions. The insertion of the don't care gates creates a first intermediate circuit and a second interme... | 01/11/2005 |
| 6833437 | Complement receptor type 1 (CR1)-like sequences Replacement of codons in DNA encoding the first three SCRs of LHR-A of CR1 with others encoding the predicted amino acids in the CR1-like sequence can give rise to chimeric genes which can be expressed to give active complement inhibitors with functional complement ... | 12/21/2004 |
| 6826164 | Method and apparatus for multiplexing in a wireless communication infrastructure A network includes a plurality of antennas coupled to a plurality of base stations. The network can be optical or constructed with RF microwave links. The antennas and base stations are configured to transmit and receive digital signals representing cellular signals... | 11/30/2004 |
| 6822978 | Remote UV laser system and methods of use A laser apparatus includes a modelocked laser system with a high reflector and an output coupler that define an oscillator cavity. An output beam is produced from the oscillator cavity. A gain medium and a modelocking device are positioned in the oscillator cavity. ... | 11/23/2004 |
| 6812152 | Method to obtain contamination free laser mirrors and passivation of these A method to obtain contamination free surfaces of a material chosen from the group comprising GaAs, GaAlAs, InGaAs, InGaAsP and InGaAs at crystal mirror facets for GaAs based laser cavities. The crystal mirrors facets are cleaved out exposed to an ambient atmosphere... | 11/02/2004 |
| D497246 | Pill box | 10/19/2004 |
| 6801949 | Distributed server cluster with graphical user interface A scalable, distributed, highly available, load balancing server system having multiple machines is provided that functions as a front server layer between a network (such as the Internet) and a back-end server layer having multiple machines functioning as Web file ... | 10/05/2004 |
| 6799541 | Cylinder sleeve with coolant groove A cylinder sleeve for an internal combustion engine having an engine block and a cylinder head. The cylinder sleeve includes a cylindrical section having a top portion and a bottom portion, and configured to receive a cylinder piston that reciprocates in the block. ... | 10/05/2004 |
| 6797806 | Fragments of CR1 and their use A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compos... | 09/28/2004 |
| 6798566 | Variable optical gain equalizer and variable branching ratio beam splitter A variable optical gain equalizer in accordance with one embodiment of the present invention comprises a variable branching ratio beam splitter having a variable polarization rotator, the variable branching ratio beam splitter branching an input light beam into two ... | 09/28/2004 |
| 6770631 | Non-identical genes and their application in improved molecular adjuvants The invention provides a linear concatamer of at least two non-identical DNA sequences which, by virtue of third base redundancy of the genetic code of the codons, each encode the same polypeptide of at least 30 amino acids; wherein the concatamer comprises or consi... | 08/03/2004 |
| 6749624 | Fluid delivery apparatus A fluid delivery apparatus for introducing a fluid cooling media to a skin surface includes a template with a skin interface surface. An energy delivery device is coupled to the template. A fluid cooling media introduction member is coupled to the template. Resource... | 06/15/2004 |
| 6743584 | Molecular-biological marker for analytical electron microscopy The invention relates to plasmids derived from pBluescript KS(+), which contains more than 1, preferably 2, 7, 14, 21 and 27, respective SK primer elements, and their use in analytical electron microscopy. ... | 06/01/2004 |
| 6734453 | Devices with optical gain in silicon A photonic device includes a silicon semiconductor based superlattice. The superlattice has a plurality of layers that form a plurality of repeating units. At least one of the layers in the repeating unit is an optically active layer with at least one species of rar... | 05/11/2004 |
| 6733490 | Method and apparatus for controlling sub-clinical laser procedures with intra-operative monitoring of electrophysiological changes A method of monitoring and controlling the sub-threshold laser treatment of a patient's retina. Sensors are located on a patient to measure focal electroretinograms (FERG). A stimulating beam is delivered onto the patient's retina. A pre-treatment FERG signal is col... | 05/11/2004 |
| 6734387 | Method and apparatus for micro-machining of articles that include polymeric materials A micro-machining apparatus includes a mode-locked, infrared laser system with a high reflector and an output coupler that define an oscillator cavity which produces an output beam. A gain medium and a mode locking device are positioned in the oscillator cavity. A d... | 05/11/2004 |
| 6731769 | Upper audio range hearing apparatus and method A system and method upper auditory frequency range hearing. A speech signal is filtered, and then modulated to an upper auditory frequency range. The modulated signal is then provided to a transducer, which causes a vibration in the ear canal, the head or the neck o... | 05/04/2004 |
| 6713606 | Conjugates of soluble peptidic compounds with membrane-binding agents The present invention provides, among other things, soluble derivatives of soluble polypeptides that incorporate membrane binding elements. Methods of making these soluble derivatives, and methods of using these soluble derivatives also are provided. ... | 03/30/2004 |
| 6699483 | Cancer treatments The invention relates to a product comprised of specific combinations of cell lines intended for use as an allogeneic immunotherapy agent for the treatment of prostate cancer in humans. The heterogeneity of the immunotherapeutic matches the heterogeneity ... | 03/02/2004 |
| 6694979 | Methods and devices for use in performing pulmonary procedures An implantable flow control element is provided which prevents air from entering an isolated portion of a patient's lung. The element may permit air to escape from the isolated portion so that the element acts like a valve. Systems for implanting pulmonar... | 02/24/2004 |
| 6693417 | Micro-electronic bond degradation sensor and method of manufacture A micro-electronic bond degradation sensor includes a sensor substrate having sensor circuitry and a sensor stud and a power stud extending therefrom. The sensor circuitry includes a voltage-to-current amplifier having an input coupled to sensor stud and ... | 02/17/2004 |
| 6688071 | Concrete structure comprising anchor rods and anchor rod An anchor rod having at least one section provided with ribs or other raised portions or profiling and a threaded section at one or both ends, and having a variable transition section between the threaded section(s) and the profiled section; and a method ... | 02/10/2004 |
| 6691165 | Distributed server cluster for controlling network traffic A scalable, distributed, highly available, load balancing server system having multiple machines is provided that functions as a front server layer between a network (such as the Internet) and a back-end server layer having multiple machines functioning a... | 02/10/2004 |
| 6686180 | Method for the production of bacterial toxins Methods and compositions are provided for the enhanced production of bacterial toxins in large-scale cultures. Specifically, methods and compositions for reducing bacterial toxin expression inhibitors are providing including, but not limited to, addition ... | 02/03/2004 |
| 6682501 | Submucosal tonsillectomy apparatus and method A cell necrosis apparatus includes an elongated member with a longitudinal axis. The elongated member being is configured to be positionable and maneuverable in an oral cavity. First and second energy delivery devices are positioned at a distal portion of... | 01/27/2004 |
| 6679264 | Methods and devices for use in performing pulmonary procedures Systems, methods and devices for performing pulmonary procedures, and in particular treating lung disease. A flow control element includes a valve that prevents airflow in the inhalation direction but permits airflow in the exhalation direction. The flow ... | 01/20/2004 |
| 6670116 | Methods for the detection, quantification and differentiation of infectious versus non-infectious pathogens in a sample Methods are disclosed that permit pathogenic agent detection and differentiation between infectious and non-infectious forms. Specifically, the present invention provides for pathogenic agent detection using nucleic acid amplification and detection techni... | 12/30/2003 |
| 6671425 | Method and system for acoustically tuning a light source The present invention relates to an integrated light source having first and second optical waveguides defining a first optical coupling region for coupling light therebetween. At least one of the optical waveguides includes a gain medium configured to em... | 12/30/2003 |
| 6667827 | Beam shutter A beam shutter is provided which comprises a plane-parallel birefringent element for separation arranged to separate input light beams having orthogonal polarization directions on the same optical path; a plane-parallel birefringent element for synthesis ... | 12/23/2003 |
| 6665328 | Diode-pumped laser with funnel-coupled pump source An optically pumped laser has a gain medium positioned inside of an optical resonator cavity and disposed about a resonator optical axis. An optical pumping source is positioned outside of the optical resonator cavity. A reflective coupler with a coupler ... | 12/16/2003 |
