Bizarre Patents
Decorative Jeweled Wheel Cover
An improved wheel is provided wherein decorative items such as gem stones are embedded in either the wheel surface, a special mounting section attached to the wheel surface, or to a spoke strap that wraps around each spoke and positions embedded gem stones on the outside surface of the spoke.
PatentStorm News
Make the Most of Our Site
See this month's Top Inventors and Most Cited Patents.
Stay on top of the latest innovations by subscribing to an RSS feed.
Registered users: Manage your profile.
| Number | Title | Issue Date |
| 7419683 | Method of inhibiting side effects of pharmaceutical compositions containing amphiphilic vehicles or drug carrier molecules A method is provided for inhibiting or preventing toxicity and other unwanted effects (a) caused by solvents for pharmaceuticals which solvents or emulsifier which contain amphiphilic molecules such as polyethoxylated oils or a derivative thereof, or (b) caused by a... | 09/02/2008 |
| 7235234 | Bacterial delivery system We describe a bacterial delivery system for the delivery of DNA and antigens into cells. We constructed an attenuated bacterial vector which enters mammalian cells and ruptures delivering functional plasmid DNA and antigens into the cell cytoplasm. This Shigella ... | 06/26/2007 |
| 7175981 | Method of diagnosing stage or aggressiveness of breast and prostate cancer based on levels of fatty acid binding proteins A method of diagnosing the stage or aggressiveness of cancer and particularly breast and prostate cancer by measuring the deviation of levels of fatty acid binding proteins in mammalian tissue or body fluids from normal levels of fatty acid binding proteins. The inv... | 02/13/2007 |
| 7118758 | Transformed bacteria producing CS6 antigens as vaccines Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof. ... | 10/10/2006 |
| 7094883 | Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to th... | 08/22/2006 |
| 7045336 | Bacterial delivery system We describe a bacterial delivery system for the delivery of DNA and antigens into cells. We constructed an attenuated bacterial vector which enters mammalian cells and ruptures delivering functional plasmid DNA and antigens into the cell cytoplasm. This Shigella ... | 05/16/2006 |
| 7025963 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 04/11/2006 |
| 7018636 | Vaccine against Gram-negative bacterial infections A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LP... | 03/28/2006 |
| 6902743 | Therapeutic treatment and prevention of infections with a bioactive material(s) encapuslated within a biodegradable-bio-compatable polymeric matrix Novel burst-free, sustained release biocompatible and biodegrable microcapsules which can be programmed to release their active core for variable durations ranging from 1-100 days in an aqueous physiological environment. The microcapsules are comprised of a core of ... | 06/07/2005 |
| 6886010 | Method for data and text mining and literature-based discovery Text searching is achieved by techniques including phrase frequency analysis and phrase-co-occurrence analysis. In many cases, factor matrix analysis is also advantageously applied to select high technical content phrases to be analyzed for possible inclusion within... | 04/26/2005 |
| 6872398 | Conjugate vaccine against gram-negative bacterial infections The present invention relates to a broadly reactive vaccine against Gram-negative bacteria which is composed of a biological glycan-pilus conjugate. The conjugate core is a common pilus type to which is attached the glycan of choice in vivo. Pooling of these bioconj... | 03/29/2005 |
| 6805957 | Camouflage U.S. Marine corps utility uniform: pattern, fabric, and design A disruptive camouflage pattern system to be used for both military and civilian applications. The system includes specialized techniques for printing the camouflage pattern system unto fabric. The system provides camouflage in both the human visible light and the n... | 10/19/2004 |
| 6770479 | Anthrax vaccine Using the nontoxic PA protein from B. anthracis, a method and composition for use in inducing an immune response which is protective against anthrax in subjects is described. ... | 08/03/2004 |
| 6753155 | Protein biomarker for mustard chemical injury This invention relates to the discovery that toxicity to mustard may be evaluated by diagnostic test means disclosed herein. Upon electrophoretic separation (sodium dodocyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE)) of buffered extract of human skin cell... | 06/22/2004 |
| D491372 | Camouflage pattern for sheet material and uniforms | 06/15/2004 |
| 6713284 | Bacterial superantigen vaccines The present invention relates to genetically attenuated superantigen toxin vaccines altered such that superantigen attributes are absent, however the superantigen is effectively recognized and an appropriate immune response is produced. The attenuated superantigen t... | 03/30/2004 |
| 6672323 | Multi-purpose self-erecting structure having advanced insect protection and storage characteristics The self-erecting structure has resilient lower and upper support loops which provide it with shape and support. Fabric covers the support loops, and is permanently affixed to the support loops. The fabric has a lower, waterproof portion and an upper inse... | 01/06/2004 |
| 6667158 | Antibodies against type a botulinum neurotoxin Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a sample and/or in a method for purifying BoNT/A from an impure s... | 12/23/2003 |
| 6654736 | Chemical information systems A chemical information system having a graphical user interface that allows manipulation of multiple databases having related material and information. The system includes a server and multiple workstations communicating with the server. The databases res... | 11/25/2003 |
| 6641815 | Sequestrin In this application is described the expression cloning and functional characterization of the CD36-binding domain of Sequestrin. Sequestrin is a surface protein of 215-250 kD size which does not vary in size between parasite strains. The Sequestrin gene ... | 11/04/2003 |
| 6632640 | Vaccine against Staphylococcus intoxication Using nucleic acids encoding mutant SEA and SEB exotoxins from Staphylococcus aureus, compositions and methods for use in inducing an immune response which is protective against staphylococcal aureus intoxication in subjects is described.... | 10/14/2003 |
| 6610531 | Viable dried bacteria produced by drying in the presence of trehalose and divalent cation A method is provided for preserving live bacteria by subjecting an aqueous system containing the growing bacteria to drying without special equipment, in the presence of trehalose with or without the addition of divalent cations as stabilizing agents. Fur... | 08/26/2003 |
| 6245892 | Invaplex from gram negative bacteria, method of purification and methods of use Invaplex, a novel composition comprising invasin proteins and LPS from gram-negative bacteria is described as well as methods of using the novel composition as an adjuvant and a diagnostic tool.... | 06/12/2001 |
| 6241686 | System and method for predicting human cognitive performance using data from an actigraph A system and a method for providing a determination of predicted cognitive performance of an individual based the time of day and on factors including sleep history based on activity data from an actigraph. The system and the method provide a numerical re... | 06/05/2001 |
| 6046200 | Compositions having neuroprotective and analgesic activity Compounds of the formula: ##STR1## wherein R1 and R2 are alkyl of 1-8 carbons have been shown to have both neuroprotective and analgesic activities. The compounds of the invention may be used in treatment of conditions that woul... | 04/04/2000 |
