Assignee: The University of Queensland

Location: Queensland, AU
No. of patents: 53

Number	Title	Issue Date
8100581	Method of determining the presence of a mineral within a material The invention relates generally to a method of determining the presence of a mineral within a material, such as a rock, a rock fragment, soil, sand or other geological material including: applying pulsed microwave radiation to the material; detecting radiation emitt...	01/24/2012
8022269	Altered metabolism The present invention relates to methods for increasing the yield of a compound produced by an organism. More particularly, the present invention relates to methods for increasing the total or soluble carbohydrate content or sweetness or increasing the content of an...	09/20/2011
7936168	Magnetic field dosimeter A portable device is used to measure exposure to magnetic fields and/or exposure to changes of magnetic field. The device (10) includes a first sensor (14) for measuring instantaneous magnetic field strength, and a second sensor (15) which is lo...	05/03/2011
7704742	Method and polynucleotides for determining translational efficiency of a codon A method is disclosed for determining the translational efficiency of an individual codon in a cell. The method includes introducing into the cell a synthetic construct including a reporter polynucleotide fused in frame with a tandem repeat of the individual codon, ...	04/27/2010
7478074	Support vector machine A method for operating a computer as a support vector machine (SVM) in order to define a decision surface separating two opposing classes of a training set of vectors. The method involves associating a distance parameter with each vector of the SVM's training set. T...	01/13/2009
7476389	Papillomavirus vaccines A method of providing papilloma virus like particles which may be used for diagnostic purposes or for incorporation in a vaccine for use in related to infections caused by papilloma virus. The method includes an initial step of constructing one or more recombinant D...	01/13/2009
7435586	Method of purification of cells The present invention relates generally to a method for the generation of a substantially homogeneous population of undifferentiated cells. More particularly, the present invention relates to the purification of a substantially homogeneous population of stem cells a...	10/14/2008
7358329	Antagonists to chaperonin 10 Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO:21). Antibodies are raised against either ...	04/15/2008
7338455	Method and apparatus for diagnosing schizophrenia and schizophrenia subtype A method and apparatus for diagnosing schizophrenia, schizophrenia disorder subgroup, or predisposition thereto in a test subject is disclosed. The method includes the steps of determining an interhemispheric switch rate of the test subject. In one embodiment, the i...	03/04/2008
7330026	Method and apparatus for mapping and correcting geometric distortion in MRI A three-dimensional grid (10) is used as a phantom for mapping geometric distortion in magnetic resonance imaging (MRI) apparatus. This phantom provides an array of densely distributed control points in three-dimensional space. These points are each defined b...	02/12/2008
7312195	Cyclised conotoxin peptides This invention relates to cyclised conotoxin peptides, processes for their preparation and their pharmaceutical use. ...	12/25/2007
7262337	Method for modifying a plant phenotype The present invention relates generally to methods for generating plants having altered phenotypes, and to plants so generated and parts of these plants. More particularly, the present invention relates to a method for modifying a plant so as to produce a plant exhi...	08/28/2007
7253194	Compounds and inhibitors of phospholipases The present invention relates generally to amino acid derivatives and to methods of making the same. In particular, the invention relates to compounds bearing a stereochemical identity, that is, the same stereochemistry, with the chiral α-carbon of D-α-amino acids...	08/07/2007
7173272	Quantum optical CNOT gate A nondeterministic quantum CNOT gate (10) for photon qubits, with success probability 1/9, uses beamsplitters (B1–B5) with selected reflectivities to mix control and target input modes. It may be combined with an atomic quantum memory to const...	02/06/2007
7101849	ωconotoxin peptides An isolated, synthetic, or recombinant ω-conotoxin peptide in which the fourth loop between cysteine residues 5 and 6 comprises SEQ ID NO: 1 or such a sequence which has undergone one or more amino acid substitutions or side chain modifications, and uses therefor. ...	09/05/2006
7092825	Protein engineering A method of protein engineering is provided wherein a searchable computer database is created comprising entries in the form of descriptions of a location and orientation in 3D space of side chains of the constituent amino acid residues of a framework protein. A que...	08/15/2006
7067624	Antimicrobial proteins A new family of antimicrobial proteins is described. Prototype proteins can be isolated from Macadamia integrifolia as well as other plant species. DNA encoding the protein is also described as well as DNA constructs which can be used to express the antimicro...	06/27/2006
7041483	Expression modulating sequences The present invention provides a method for modulating expression of a genetic sequence by introducing, creating or deleting one or more pseudo-translation initiation sites in the nucleotide sequence of an mRNA, upstream of the authentic translation initiation site ...	05/09/2006
7001883	Cyclized conotoxin peptides This invention relates to cyclized conotoxin peptides, processes for their preparation and their pharmaceutical use. ...	02/21/2006
6943123	Silica membranes and process of production thereof A method of producing a weakly branched silica membranes coated onto a substrate using a two-step catalysed hydrolysis sol-gel process. A tetraethylorthosilicate (TEOS)/ethanol solution is formed and placed in an ice bath. An acid/water solution is formed and added ...	09/13/2005
6846671	Method and polynucleotides for determining translational efficiency of a codon A method is disclosed for determining the translational efficiency of an individual codon in a cell. The method comprises introducing into the cell a synthetic construct comprising a reporter polynucleotide fused in frame with a tandem repeat of said individual codo...	01/25/2005
6794361	Peptides The invention relates to an isolated, synthetic or recombinant χ-conotoxin peptide having the ability to inhibit a neuronal amine transporter, nucleic acid molecules encoding all or part of such peptides, antibodies to such peptides and uses and methods of treatmen...	09/21/2004
6760617	Method and device for measuring tissue oedema The present invention provides a method of assessing tissue oedema, in particular lymphoedema, by measuring bioelectrical impedance at a single frequency. Comparison of a single frequency bioelectrical impedance measurement taken at an anatomical region affected by ...	07/06/2004
6629935	Method and apparatus for diagnosis of a mood disorder or predisposition therefor A method for diagnosis of a mood disorder or predisposition therefor in a test subject is disclosed. The method includes the steps of determining an interhemispheric switch rate of the test subject, and comparing the switch rate with a corresponding refer...	10/07/2003
6607729	Surface antigen The invention provides a novel surface polypeptide from Neisseria meningitidis as well as nucleic acid and nucleic acid sequence homologues encoding this protein. Pharmaceutical compositions containing the polypeptide and nucleic acids of the invention ar...	08/19/2003
6475157	Seal for use in a volume displacement plethysmograph Disclosed is a neck seal for use in a volume displacement plethysmograph for investigating pulmonary function of infants. The neck seal includes particulate material entrapped in a space between two layers of flexible sheets. The two flexible sheets have ...	11/05/2002
6417334	Antagonists to chaperonin 10 Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLL PEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entir...	07/09/2002
6388175	Control of leaf scald disease A method of substantially reducing or inhibiting the development of leaf scald disease in a plant or stalk thereof, said method comprising the step of administering an albicidin detoxification enzyme to the plant or stalk thereof. There is also provided a...	05/14/2002
6365160	Papillomavirus polyprotein constructs Peptides, antibodies and recombinant expression systems or cells that contain and express a DNA insert of HPV encoding a region of a papilloma induced or a papilloma protein, such as E6 or E7, are produced. Compositions containing these peptides, antibodi...	04/02/2002
6310072	Production of analgesic synergy by co-administration of sub-analgesic doses of a MU opioid agonist and a kappa-2 opioid agonist An analgesic composition is disclosed comprising a sub-analgesic dosage of a μ-opioid agonist, optionally in the form of a pharmaceutically acceptable salt, and a sub-analgesic dosage of a .kappa.2 -opioid agonist, optionally in the form of a ...	10/30/2001
6236734	Detection of defects in glass Defects in window glass, particularly nickel sulfide stones, are detected by photographing portions of the window glass onto photographic film in controlled lighting conditions, and then optically magnifying the photographic film images. The magnified ima...	05/22/2001
6218329	Process for forming alumino-silicate derivatives A process for the preparation of an amorphous alumino-silicate derivative which involves reacting a solid corresponding starting material with MOH where M is alkali metal or ammonium cation. The solid corresponding starting material may be selected from m...	04/17/2001
6200919	Alumino-silicate derivatives The formation of new materials in the form of alumino-silicate derivatives from 2:1 layer clay materials which are obtained by the chemical modification of 2:1 layer clay minerals by reaction with a salt having the formula MX wherein M is ammonium ion or ...	03/13/2001
6197312	Surface antigen The invention provides a novel surface polypeptide from Neisseria meningitidis as well as nucleic acid and nucleic acid sequence homologues encoding this protein. Pharmaceutical compositions containing the polypeptide and nucleic acids of the invention ar...	03/06/2001
6194639	ACC synthase genes from pineapple New ACC synthase genes from pineapple are disclosed which have utility as targets for the generation of transgenic plants in which the expression of ACC synthase is substantially controlled to effect the regulation of plant development, and, in particular...	02/27/2001
6183745	Subunit papilloma virus vaccine and peptides for use therein The invention relates to a subunit papillomavirus vaccine which is protective against anogenital human Papillomavirus (HPV) infection. Peptides are also provided, which constitute an antigenic component of the vaccine. The peptide includes the sequence DR...	02/06/2001
6124833	Radial line slot antenna A flat radial line slot antenna having a radial waveguide is disclosed. The antenna has a front plate and a rear plate, the front plate having an array of radiating slots and an array of reflection cancelling slots formed in the rear plate....	09/26/2000
6124525	ACC synthase genes from pineapple, papaya and mango New ACC synthase genes from pineapple, papaya and mango are disclosed which have utility as targets for the generation of transgenic plants in which the expression of ACC synthase is substantially controlled to effect the regulation of plant development, ...	09/26/2000
6117421	Method for promoting cell growth and immunosuppression using chaperonin A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of...	09/12/2000
6113899	Antagonists of chaperonin 10 An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antag...	09/05/2000

«First «Previous1 2 Next»Last»

PatentStorm

Bizarre Patents

PatentStorm News

Assignee: The University of Queensland